Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F7ZZ67

Protein Details
Accession A0A0F7ZZ67   
Localization Confidence Low
Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
44-79RADLEARRRRCPKKYHRHEGKCCRRHTLRRTYYDCHBasic
NLS Segment(s)
Subcellular Location(s) mito 10, cyto 9, nucl 5, plas 1, extr 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MLLSQFLATAFLAMGTVSALPQVNPEGAVEVRDIEGMEGDLAARADLEARRRRCPKKYHRHEGKCCRRHTLRRTYYDCHPW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.04
4 0.04
5 0.05
6 0.05
7 0.05
8 0.07
9 0.08
10 0.08
11 0.08
12 0.08
13 0.08
14 0.08
15 0.09
16 0.08
17 0.08
18 0.08
19 0.07
20 0.07
21 0.05
22 0.05
23 0.04
24 0.04
25 0.03
26 0.03
27 0.03
28 0.03
29 0.03
30 0.03
31 0.03
32 0.04
33 0.06
34 0.14
35 0.21
36 0.25
37 0.34
38 0.43
39 0.5
40 0.57
41 0.66
42 0.7
43 0.74
44 0.82
45 0.85
46 0.87
47 0.91
48 0.94
49 0.95
50 0.95
51 0.91
52 0.84
53 0.82
54 0.81
55 0.8
56 0.79
57 0.79
58 0.78
59 0.79
60 0.83
61 0.78