Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F8A332

Protein Details
Accession A0A0F8A332   
Localization Confidence Low
Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
47-78IHFATLKPEQRKKKKETAKKPKDNARGGPSKKBasic
NLS Segment(s)
PositionSequence
55-78EQRKKKKETAKKPKDNARGGPSKK
Subcellular Location(s) cyto 12, cyto_nucl 8, E.R. 6, extr 4, nucl 2, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MANFDFLKSIGATPEAVAVLNDQPNLFVSLIAVIIALLVEVGLLWTIHFATLKPEQRKKKKETAKKPKDNARGGPSKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.1
3 0.09
4 0.09
5 0.09
6 0.11
7 0.12
8 0.12
9 0.1
10 0.1
11 0.11
12 0.13
13 0.12
14 0.09
15 0.07
16 0.07
17 0.07
18 0.07
19 0.06
20 0.03
21 0.03
22 0.03
23 0.02
24 0.02
25 0.01
26 0.01
27 0.01
28 0.01
29 0.02
30 0.02
31 0.02
32 0.02
33 0.03
34 0.03
35 0.04
36 0.04
37 0.08
38 0.16
39 0.25
40 0.33
41 0.42
42 0.52
43 0.63
44 0.72
45 0.75
46 0.78
47 0.81
48 0.84
49 0.87
50 0.88
51 0.89
52 0.9
53 0.92
54 0.92
55 0.91
56 0.89
57 0.85
58 0.83