Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F7ZM77

Protein Details
Accession A0A0F7ZM77    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
61-80MIRSNRKKALKAKAAAKKKAHydrophilic
NLS Segment(s)
PositionSequence
65-80NRKKALKAKAAAKKKA
Subcellular Location(s) plas 17, E.R. 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MLVAASVVFLYYTVWTLLMPFVDHDHPLQNFFLPRVWAIRIPVILVLLGSAVVGSFLSMVMIRSNRKKALKAKAAAKKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.07
4 0.08
5 0.07
6 0.07
7 0.07
8 0.1
9 0.11
10 0.12
11 0.12
12 0.16
13 0.16
14 0.17
15 0.17
16 0.16
17 0.15
18 0.15
19 0.15
20 0.12
21 0.12
22 0.12
23 0.13
24 0.12
25 0.13
26 0.13
27 0.12
28 0.11
29 0.11
30 0.09
31 0.07
32 0.06
33 0.05
34 0.03
35 0.03
36 0.03
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.02
43 0.02
44 0.03
45 0.03
46 0.04
47 0.07
48 0.1
49 0.16
50 0.22
51 0.28
52 0.36
53 0.4
54 0.47
55 0.53
56 0.61
57 0.66
58 0.67
59 0.72
60 0.75