Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F7ZKL9

Protein Details
Accession A0A0F7ZKL9    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
87-115ASPSPQAYPQTRRKKSCKAKKVPPGGAGVHydrophilic
154-174GQAPDKKPVQSRPCRRPQASPHydrophilic
224-250EVDRSQPKRPCTKCKQQPQPQPKESEKHydrophilic
303-329GSTPPQGRKPCNKCKPQPQPQPQPLPNHydrophilic
388-411SPPPATPRKPCPKKPETRHQEPERBasic
419-452TPKDKDQSPPPQRKPCPKCRPRPQPQTQPKEPERHydrophilic
462-491NDTDRSPPRERKPCNKCKNRPRPTPEAGPNHydrophilic
522-549AERPPPGKPCNKCKKQPRPTQNVGPDREHydrophilic
576-601VAERPQGKPCNKCKKQPRPTQSIGQTHydrophilic
631-658EVPPQGKPCNKCKKQPPSQPKQPEPGYGHydrophilic
NLS Segment(s)
PositionSequence
100-101KK
106-106K
Subcellular Location(s) mito 13, cyto_nucl 8.5, nucl 7, cyto 4
Family & Domain DBs
Amino Acid Sequences MPQPGTSFLLLLALGSSSGALAQYQNTLITSTVRPTASALDADPASALPQVNLPGPQSQTTISSASPSPSPSTPGREPEKPSVDAAASPSPQAYPQTRRKKSCKAKKVPPGGAGVENKAPATPAVYGDGASPKEQGPCAGKAGPCKRPGVEIQGQAPDKKPVQSRPCRRPQASPASTPAPAPSRGPSVEEVLPTYGPGVKQEQDKPRKPCAGRRDRPALPETKEVDRSQPKRPCTKCKQQPQPQPKESEKTYGPPPATPQEVGKPLEPERGYGPPPVAPKEINKAPEPERGYGPPPVAPKQVGSTPPQGRKPCNKCKPQPQPQPQPLPNEPKKSYGPPPVAPKEVTPAPQPERGYGPLPVAPKEVTPAPEPERGYGPSPVAPKEGDRSPPPATPRKPCPKKPETRHQEPERGYSPPPATPKDKDQSPPPQRKPCPKCRPRPQPQTQPKEPERGYGPLPVTPNDTDRSPPRERKPCNKCKNRPRPTPEAGPNTEYGRPTPPKVEQNPPEPPRGYGPPSPPAVAERPPPGKPCNKCKKQPRPTQNVGPDREYGSPTPPKVEQSPEPPRGYGPPSPPAVAERPQGKPCNKCKKQPRPTQSIGQTPEYGRPTPQLEQSPEAPRGYGPPTPPAVAEVPPQGKPCNKCKKQPPSQPKQPEPGYGPSPSTPRPKPETKQPEQGYGPSPSGPKEQPKQPEQGYGPSPAGPKEKQPSPPTAGYPSPNSQGKPCAKCNAQTGGGVPKGYGPQAPAQPAPPSPPSYGAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.04
5 0.05
6 0.05
7 0.05
8 0.06
9 0.07
10 0.1
11 0.1
12 0.11
13 0.11
14 0.12
15 0.12
16 0.15
17 0.16
18 0.17
19 0.21
20 0.21
21 0.21
22 0.21
23 0.24
24 0.23
25 0.22
26 0.2
27 0.19
28 0.18
29 0.18
30 0.17
31 0.13
32 0.12
33 0.13
34 0.12
35 0.08
36 0.11
37 0.13
38 0.14
39 0.16
40 0.17
41 0.19
42 0.22
43 0.23
44 0.23
45 0.22
46 0.23
47 0.24
48 0.24
49 0.19
50 0.2
51 0.2
52 0.2
53 0.21
54 0.2
55 0.22
56 0.21
57 0.26
58 0.26
59 0.33
60 0.36
61 0.42
62 0.47
63 0.49
64 0.55
65 0.59
66 0.61
67 0.55
68 0.52
69 0.47
70 0.41
71 0.35
72 0.33
73 0.29
74 0.24
75 0.22
76 0.22
77 0.19
78 0.2
79 0.24
80 0.26
81 0.3
82 0.4
83 0.51
84 0.6
85 0.69
86 0.76
87 0.82
88 0.86
89 0.88
90 0.89
91 0.88
92 0.89
93 0.91
94 0.92
95 0.88
96 0.81
97 0.76
98 0.68
99 0.64
100 0.56
101 0.48
102 0.4
103 0.34
104 0.29
105 0.24
106 0.21
107 0.14
108 0.14
109 0.12
110 0.11
111 0.13
112 0.13
113 0.13
114 0.14
115 0.18
116 0.17
117 0.17
118 0.17
119 0.16
120 0.18
121 0.18
122 0.21
123 0.21
124 0.22
125 0.25
126 0.27
127 0.28
128 0.35
129 0.43
130 0.46
131 0.46
132 0.47
133 0.44
134 0.44
135 0.46
136 0.45
137 0.43
138 0.41
139 0.41
140 0.45
141 0.46
142 0.43
143 0.41
144 0.38
145 0.33
146 0.34
147 0.37
148 0.39
149 0.48
150 0.57
151 0.66
152 0.7
153 0.79
154 0.83
155 0.81
156 0.79
157 0.78
158 0.79
159 0.73
160 0.67
161 0.61
162 0.55
163 0.52
164 0.44
165 0.38
166 0.31
167 0.27
168 0.25
169 0.22
170 0.23
171 0.23
172 0.25
173 0.23
174 0.24
175 0.25
176 0.23
177 0.22
178 0.19
179 0.18
180 0.15
181 0.15
182 0.12
183 0.1
184 0.12
185 0.14
186 0.16
187 0.22
188 0.3
189 0.4
190 0.48
191 0.56
192 0.6
193 0.65
194 0.71
195 0.69
196 0.7
197 0.71
198 0.72
199 0.71
200 0.73
201 0.73
202 0.67
203 0.68
204 0.65
205 0.6
206 0.53
207 0.53
208 0.48
209 0.44
210 0.46
211 0.42
212 0.45
213 0.48
214 0.48
215 0.51
216 0.54
217 0.56
218 0.61
219 0.67
220 0.69
221 0.69
222 0.76
223 0.76
224 0.8
225 0.85
226 0.85
227 0.89
228 0.9
229 0.91
230 0.85
231 0.83
232 0.77
233 0.72
234 0.64
235 0.59
236 0.49
237 0.43
238 0.41
239 0.4
240 0.36
241 0.3
242 0.32
243 0.3
244 0.31
245 0.28
246 0.25
247 0.24
248 0.28
249 0.29
250 0.26
251 0.26
252 0.25
253 0.31
254 0.29
255 0.25
256 0.23
257 0.25
258 0.25
259 0.23
260 0.23
261 0.19
262 0.22
263 0.23
264 0.22
265 0.2
266 0.21
267 0.27
268 0.3
269 0.29
270 0.28
271 0.3
272 0.31
273 0.37
274 0.38
275 0.33
276 0.32
277 0.31
278 0.32
279 0.3
280 0.28
281 0.24
282 0.24
283 0.25
284 0.24
285 0.22
286 0.21
287 0.2
288 0.23
289 0.22
290 0.23
291 0.29
292 0.34
293 0.39
294 0.45
295 0.47
296 0.49
297 0.57
298 0.63
299 0.65
300 0.68
301 0.72
302 0.73
303 0.8
304 0.85
305 0.86
306 0.87
307 0.86
308 0.87
309 0.86
310 0.87
311 0.8
312 0.76
313 0.71
314 0.7
315 0.66
316 0.63
317 0.56
318 0.51
319 0.5
320 0.47
321 0.48
322 0.46
323 0.45
324 0.41
325 0.47
326 0.46
327 0.46
328 0.42
329 0.36
330 0.32
331 0.29
332 0.27
333 0.21
334 0.23
335 0.24
336 0.28
337 0.28
338 0.25
339 0.26
340 0.26
341 0.25
342 0.21
343 0.19
344 0.17
345 0.18
346 0.17
347 0.16
348 0.14
349 0.13
350 0.13
351 0.13
352 0.12
353 0.13
354 0.16
355 0.18
356 0.22
357 0.23
358 0.22
359 0.23
360 0.22
361 0.23
362 0.2
363 0.17
364 0.16
365 0.17
366 0.17
367 0.16
368 0.15
369 0.14
370 0.16
371 0.18
372 0.18
373 0.18
374 0.22
375 0.23
376 0.25
377 0.3
378 0.35
379 0.37
380 0.4
381 0.48
382 0.55
383 0.61
384 0.66
385 0.71
386 0.72
387 0.78
388 0.8
389 0.82
390 0.8
391 0.81
392 0.83
393 0.79
394 0.77
395 0.68
396 0.65
397 0.56
398 0.49
399 0.4
400 0.35
401 0.31
402 0.27
403 0.29
404 0.27
405 0.3
406 0.3
407 0.36
408 0.36
409 0.38
410 0.37
411 0.4
412 0.47
413 0.53
414 0.61
415 0.63
416 0.68
417 0.71
418 0.79
419 0.81
420 0.81
421 0.82
422 0.82
423 0.84
424 0.85
425 0.9
426 0.9
427 0.92
428 0.91
429 0.91
430 0.91
431 0.9
432 0.85
433 0.83
434 0.75
435 0.73
436 0.63
437 0.56
438 0.48
439 0.42
440 0.36
441 0.32
442 0.3
443 0.24
444 0.25
445 0.22
446 0.23
447 0.21
448 0.22
449 0.19
450 0.19
451 0.19
452 0.22
453 0.29
454 0.33
455 0.4
456 0.47
457 0.55
458 0.61
459 0.69
460 0.75
461 0.79
462 0.83
463 0.86
464 0.87
465 0.88
466 0.93
467 0.93
468 0.92
469 0.89
470 0.87
471 0.82
472 0.8
473 0.77
474 0.73
475 0.66
476 0.57
477 0.52
478 0.45
479 0.42
480 0.33
481 0.27
482 0.26
483 0.26
484 0.26
485 0.29
486 0.31
487 0.37
488 0.42
489 0.5
490 0.48
491 0.52
492 0.61
493 0.59
494 0.59
495 0.51
496 0.47
497 0.42
498 0.42
499 0.39
500 0.35
501 0.36
502 0.36
503 0.37
504 0.36
505 0.32
506 0.3
507 0.29
508 0.26
509 0.25
510 0.27
511 0.3
512 0.32
513 0.35
514 0.38
515 0.43
516 0.47
517 0.55
518 0.59
519 0.64
520 0.71
521 0.78
522 0.84
523 0.86
524 0.9
525 0.89
526 0.88
527 0.87
528 0.87
529 0.86
530 0.83
531 0.76
532 0.68
533 0.59
534 0.52
535 0.46
536 0.4
537 0.31
538 0.29
539 0.31
540 0.28
541 0.3
542 0.29
543 0.3
544 0.3
545 0.35
546 0.32
547 0.37
548 0.46
549 0.49
550 0.5
551 0.47
552 0.45
553 0.44
554 0.44
555 0.4
556 0.34
557 0.32
558 0.32
559 0.32
560 0.31
561 0.31
562 0.3
563 0.28
564 0.29
565 0.29
566 0.33
567 0.39
568 0.47
569 0.49
570 0.54
571 0.62
572 0.68
573 0.68
574 0.73
575 0.78
576 0.81
577 0.86
578 0.88
579 0.86
580 0.84
581 0.84
582 0.83
583 0.79
584 0.76
585 0.7
586 0.62
587 0.56
588 0.48
589 0.49
590 0.43
591 0.38
592 0.3
593 0.3
594 0.31
595 0.3
596 0.35
597 0.35
598 0.35
599 0.38
600 0.42
601 0.44
602 0.43
603 0.4
604 0.34
605 0.28
606 0.28
607 0.28
608 0.27
609 0.23
610 0.25
611 0.27
612 0.28
613 0.27
614 0.27
615 0.25
616 0.22
617 0.23
618 0.25
619 0.26
620 0.28
621 0.3
622 0.31
623 0.35
624 0.39
625 0.47
626 0.51
627 0.55
628 0.61
629 0.7
630 0.77
631 0.81
632 0.87
633 0.87
634 0.87
635 0.92
636 0.93
637 0.89
638 0.87
639 0.8
640 0.75
641 0.69
642 0.65
643 0.58
644 0.49
645 0.45
646 0.39
647 0.41
648 0.4
649 0.44
650 0.42
651 0.46
652 0.52
653 0.58
654 0.6
655 0.66
656 0.71
657 0.7
658 0.75
659 0.71
660 0.72
661 0.65
662 0.64
663 0.57
664 0.5
665 0.45
666 0.37
667 0.36
668 0.3
669 0.33
670 0.35
671 0.39
672 0.43
673 0.49
674 0.55
675 0.59
676 0.65
677 0.61
678 0.64
679 0.58
680 0.58
681 0.53
682 0.49
683 0.44
684 0.39
685 0.39
686 0.34
687 0.37
688 0.31
689 0.37
690 0.41
691 0.46
692 0.52
693 0.55
694 0.58
695 0.59
696 0.62
697 0.58
698 0.56
699 0.54
700 0.5
701 0.51
702 0.48
703 0.48
704 0.48
705 0.45
706 0.43
707 0.48
708 0.53
709 0.54
710 0.56
711 0.57
712 0.57
713 0.6
714 0.63
715 0.6
716 0.53
717 0.48
718 0.45
719 0.44
720 0.42
721 0.37
722 0.31
723 0.27
724 0.27
725 0.27
726 0.25
727 0.2
728 0.24
729 0.3
730 0.34
731 0.33
732 0.33
733 0.36
734 0.36
735 0.39
736 0.37
737 0.36
738 0.34