Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F7ZLR0

Protein Details
Accession A0A0F7ZLR0   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
69-122QTKAAKPKAKTTAKKPAKKTKAPAKRKVKAKAKKPKPKKPKKPKTLTPEEKEKVBasic
NLS Segment(s)
PositionSequence
56-121KKASTTRKAAVSKQTKAAKPKAKTTAKKPAKKTKAPAKRKVKAKAKKPKPKKPKKPKTLTPEEKEK
Subcellular Location(s) mito 19, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
Amino Acid Sequences MLTSIGRAAARRSLTTASSRHVASVRSAAALTRVAGSPRFISASIRSHAAVAAASKKASTTRKAAVSKQTKAAKPKAKTTAKKPAKKTKAPAKRKVKAKAKKPKPKKPKKPKTLTPEEKEKVLVRELKKLALLKGPTRGSPNVWSLFLKENFPKGGGSLAEKIAPLKQQFANLSQLELKKQRDSVTKKREQGEWVAAHPPEVIYLANRARRHLARRSQNADDKKPRLLLIRDERLPKRPNGPFVTFLTSRIPDLDMSNNTSVFRDLAAEWRSMSDASKKPFIDAAAEETRKTAAQRDAIRQKAKEYMKQQHPAVKAIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.34
3 0.34
4 0.32
5 0.33
6 0.32
7 0.32
8 0.31
9 0.29
10 0.26
11 0.29
12 0.25
13 0.23
14 0.23
15 0.2
16 0.19
17 0.19
18 0.16
19 0.13
20 0.14
21 0.14
22 0.15
23 0.17
24 0.16
25 0.17
26 0.18
27 0.16
28 0.18
29 0.22
30 0.26
31 0.26
32 0.27
33 0.25
34 0.24
35 0.23
36 0.21
37 0.16
38 0.13
39 0.16
40 0.15
41 0.15
42 0.14
43 0.15
44 0.21
45 0.25
46 0.27
47 0.28
48 0.33
49 0.42
50 0.46
51 0.51
52 0.55
53 0.59
54 0.58
55 0.61
56 0.63
57 0.59
58 0.63
59 0.67
60 0.66
61 0.62
62 0.66
63 0.68
64 0.7
65 0.73
66 0.73
67 0.75
68 0.76
69 0.8
70 0.81
71 0.82
72 0.82
73 0.83
74 0.83
75 0.83
76 0.84
77 0.85
78 0.87
79 0.86
80 0.85
81 0.86
82 0.87
83 0.86
84 0.84
85 0.85
86 0.85
87 0.86
88 0.88
89 0.9
90 0.91
91 0.92
92 0.94
93 0.95
94 0.95
95 0.95
96 0.95
97 0.95
98 0.93
99 0.92
100 0.92
101 0.9
102 0.84
103 0.84
104 0.74
105 0.64
106 0.58
107 0.5
108 0.4
109 0.35
110 0.36
111 0.27
112 0.34
113 0.34
114 0.33
115 0.33
116 0.33
117 0.29
118 0.27
119 0.28
120 0.22
121 0.28
122 0.28
123 0.27
124 0.29
125 0.28
126 0.25
127 0.26
128 0.28
129 0.23
130 0.23
131 0.22
132 0.2
133 0.25
134 0.24
135 0.23
136 0.2
137 0.21
138 0.2
139 0.2
140 0.18
141 0.12
142 0.13
143 0.1
144 0.11
145 0.11
146 0.11
147 0.11
148 0.11
149 0.11
150 0.11
151 0.13
152 0.12
153 0.14
154 0.14
155 0.17
156 0.18
157 0.2
158 0.24
159 0.21
160 0.21
161 0.21
162 0.21
163 0.22
164 0.26
165 0.26
166 0.22
167 0.24
168 0.27
169 0.33
170 0.4
171 0.47
172 0.53
173 0.58
174 0.62
175 0.63
176 0.62
177 0.56
178 0.52
179 0.49
180 0.4
181 0.34
182 0.32
183 0.29
184 0.26
185 0.23
186 0.18
187 0.11
188 0.1
189 0.09
190 0.05
191 0.1
192 0.15
193 0.2
194 0.21
195 0.22
196 0.27
197 0.32
198 0.38
199 0.42
200 0.48
201 0.52
202 0.6
203 0.65
204 0.66
205 0.7
206 0.71
207 0.71
208 0.71
209 0.64
210 0.59
211 0.55
212 0.49
213 0.47
214 0.43
215 0.43
216 0.43
217 0.48
218 0.49
219 0.54
220 0.56
221 0.58
222 0.59
223 0.53
224 0.53
225 0.5
226 0.54
227 0.53
228 0.54
229 0.5
230 0.49
231 0.52
232 0.43
233 0.4
234 0.37
235 0.31
236 0.27
237 0.24
238 0.22
239 0.16
240 0.18
241 0.22
242 0.19
243 0.23
244 0.24
245 0.24
246 0.23
247 0.23
248 0.21
249 0.16
250 0.14
251 0.11
252 0.1
253 0.17
254 0.18
255 0.18
256 0.18
257 0.19
258 0.19
259 0.18
260 0.2
261 0.21
262 0.25
263 0.29
264 0.36
265 0.35
266 0.36
267 0.37
268 0.36
269 0.32
270 0.27
271 0.29
272 0.32
273 0.32
274 0.31
275 0.29
276 0.3
277 0.27
278 0.27
279 0.26
280 0.23
281 0.3
282 0.37
283 0.46
284 0.55
285 0.62
286 0.68
287 0.63
288 0.61
289 0.62
290 0.62
291 0.61
292 0.61
293 0.63
294 0.65
295 0.72
296 0.73
297 0.72
298 0.68