Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F7ZGR6

Protein Details
Accession A0A0F7ZGR6   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
117-140HVDPPRRAARRRRGARPRAHARAVBasic
NLS Segment(s)
PositionSequence
120-154PPRRAARRRRGARPRAHARAVLALWRGRGRRLGAR
Subcellular Location(s) nucl 9.5, cyto_nucl 7.5, mito 6, extr 5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009784  DUF1349  
Pfam View protein in Pfam  
PF07081  DUF1349  
Amino Acid Sequences MASSTFTLAADPDTDIWKKPPSHDVFTAPYRTLAKRPTRSFVSASLTFSAPYAHQFDQAGLLLIFARPSAPGTPRKWLKAGVELFDGLPRLSTVACDAWSDWSVAPVGGGGASAGHHVDPPRRAARRRRGARPRAHARAVLALWRGRGRRLGARDCGGRGAALQGRRGQARGHVSGLQGRVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.21
4 0.26
5 0.28
6 0.3
7 0.39
8 0.41
9 0.46
10 0.48
11 0.5
12 0.48
13 0.51
14 0.51
15 0.42
16 0.39
17 0.36
18 0.35
19 0.35
20 0.38
21 0.43
22 0.49
23 0.53
24 0.55
25 0.57
26 0.58
27 0.55
28 0.51
29 0.48
30 0.4
31 0.38
32 0.34
33 0.28
34 0.25
35 0.23
36 0.19
37 0.12
38 0.13
39 0.15
40 0.14
41 0.15
42 0.16
43 0.16
44 0.17
45 0.16
46 0.15
47 0.09
48 0.09
49 0.07
50 0.07
51 0.07
52 0.05
53 0.05
54 0.04
55 0.05
56 0.07
57 0.11
58 0.18
59 0.2
60 0.29
61 0.33
62 0.35
63 0.35
64 0.36
65 0.34
66 0.35
67 0.35
68 0.27
69 0.25
70 0.23
71 0.22
72 0.19
73 0.18
74 0.09
75 0.08
76 0.06
77 0.05
78 0.05
79 0.05
80 0.05
81 0.06
82 0.06
83 0.07
84 0.07
85 0.08
86 0.09
87 0.1
88 0.08
89 0.08
90 0.08
91 0.07
92 0.07
93 0.05
94 0.04
95 0.03
96 0.03
97 0.02
98 0.02
99 0.03
100 0.03
101 0.04
102 0.04
103 0.05
104 0.07
105 0.11
106 0.12
107 0.18
108 0.25
109 0.31
110 0.38
111 0.47
112 0.57
113 0.64
114 0.71
115 0.76
116 0.8
117 0.84
118 0.86
119 0.87
120 0.86
121 0.82
122 0.77
123 0.68
124 0.59
125 0.54
126 0.45
127 0.39
128 0.32
129 0.26
130 0.25
131 0.29
132 0.28
133 0.25
134 0.29
135 0.29
136 0.34
137 0.4
138 0.45
139 0.46
140 0.5
141 0.52
142 0.48
143 0.46
144 0.38
145 0.3
146 0.24
147 0.23
148 0.22
149 0.21
150 0.24
151 0.26
152 0.3
153 0.32
154 0.33
155 0.29
156 0.32
157 0.36
158 0.36
159 0.35
160 0.33
161 0.34
162 0.38