Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F8A1R0

Protein Details
Accession A0A0F8A1R0    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
35-65HLDNRHLRPPRHPRRRRKTHRHDTTQRGPYSBasic
NLS Segment(s)
PositionSequence
41-55LRPPRHPRRRRKTHR
Subcellular Location(s) nucl 22, cyto_nucl 15, cyto 4
Family & Domain DBs
Amino Acid Sequences MLPPTLTNTRTATDDDDDDDYDSDNDDDDNDDDNHLDNRHLRPPRHPRRRRKTHRHDTTQRGPYSLNIQPSRRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.22
3 0.22
4 0.21
5 0.2
6 0.18
7 0.15
8 0.12
9 0.12
10 0.09
11 0.08
12 0.07
13 0.06
14 0.07
15 0.07
16 0.09
17 0.09
18 0.09
19 0.09
20 0.1
21 0.11
22 0.1
23 0.1
24 0.11
25 0.13
26 0.2
27 0.26
28 0.26
29 0.35
30 0.46
31 0.56
32 0.65
33 0.72
34 0.76
35 0.82
36 0.92
37 0.94
38 0.94
39 0.94
40 0.94
41 0.95
42 0.95
43 0.94
44 0.92
45 0.91
46 0.88
47 0.78
48 0.68
49 0.58
50 0.5
51 0.47
52 0.41
53 0.41
54 0.38