Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q4WHB8

Protein Details
Accession Q4WHB8    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
68-99SSCYTTSRRKCLGRKRTWRKGKRIWSASNSSMHydrophilic
NLS Segment(s)
PositionSequence
80-90GRKRTWRKGKR
Subcellular Location(s) mito 17.5, mito_nucl 12.5, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0003723  F:RNA binding  
KEGG afm:AFUA_2G05960  -  
Pfam View protein in Pfam  
PF00076  RRM_1  
Amino Acid Sequences MSRKLAPEANRILFVKNLNYNVTAEQLFDLFGKFGPIRVPLLSYTKTFTTPNRHAISSMDSIFRTDTSSCYTTSRRKCLGRKRTWRKGKRIWSASNSSMG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.33
3 0.3
4 0.3
5 0.27
6 0.28
7 0.27
8 0.25
9 0.26
10 0.2
11 0.15
12 0.13
13 0.11
14 0.1
15 0.09
16 0.09
17 0.06
18 0.06
19 0.09
20 0.08
21 0.09
22 0.1
23 0.11
24 0.12
25 0.12
26 0.14
27 0.12
28 0.16
29 0.17
30 0.16
31 0.17
32 0.16
33 0.18
34 0.18
35 0.2
36 0.25
37 0.27
38 0.34
39 0.34
40 0.33
41 0.32
42 0.32
43 0.32
44 0.26
45 0.24
46 0.18
47 0.16
48 0.16
49 0.16
50 0.15
51 0.13
52 0.1
53 0.11
54 0.14
55 0.16
56 0.16
57 0.19
58 0.24
59 0.32
60 0.39
61 0.45
62 0.47
63 0.54
64 0.63
65 0.7
66 0.76
67 0.78
68 0.82
69 0.85
70 0.89
71 0.92
72 0.93
73 0.92
74 0.92
75 0.91
76 0.91
77 0.89
78 0.87
79 0.84
80 0.82