Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F7ZL30

Protein Details
Accession A0A0F7ZL30    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
177-199VENPPARKPGRPKKDKTAAAPVAHydrophilic
NLS Segment(s)
PositionSequence
181-201PARKPGRPKKDKTAAAPVAPA
203-204GR
Subcellular Location(s) cyto 24, mito 2
Family & Domain DBs
Amino Acid Sequences MADGIAIAIDKVGAPAPSAPEAKAGAPTVDTSGALNSPVKEDHPSLPEKPTNVADGAGSAVAAPKPVEVKSVPETPVNGATPAGGTPRPELKIVEEPSAASAATARLASPPANSSEGAAAIPSAPTEPAAGEKRKLGEGTVDDAAPPAAEAGSESPAKKAKVDQEAPAKVNGDAPVVENPPARKPGRPKKDKTAAAPVAPAMGRTARKTRSQGPAEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.09
3 0.12
4 0.17
5 0.18
6 0.18
7 0.19
8 0.2
9 0.2
10 0.21
11 0.19
12 0.15
13 0.15
14 0.15
15 0.15
16 0.14
17 0.13
18 0.11
19 0.11
20 0.11
21 0.12
22 0.13
23 0.11
24 0.12
25 0.13
26 0.14
27 0.17
28 0.19
29 0.21
30 0.24
31 0.28
32 0.28
33 0.34
34 0.35
35 0.33
36 0.34
37 0.31
38 0.29
39 0.25
40 0.23
41 0.16
42 0.14
43 0.13
44 0.09
45 0.08
46 0.05
47 0.06
48 0.05
49 0.06
50 0.06
51 0.06
52 0.08
53 0.08
54 0.11
55 0.1
56 0.15
57 0.18
58 0.22
59 0.23
60 0.23
61 0.23
62 0.22
63 0.25
64 0.21
65 0.17
66 0.13
67 0.12
68 0.11
69 0.1
70 0.1
71 0.08
72 0.08
73 0.1
74 0.13
75 0.15
76 0.15
77 0.15
78 0.17
79 0.24
80 0.25
81 0.25
82 0.21
83 0.2
84 0.2
85 0.2
86 0.16
87 0.08
88 0.06
89 0.05
90 0.05
91 0.05
92 0.04
93 0.05
94 0.06
95 0.06
96 0.06
97 0.07
98 0.09
99 0.1
100 0.1
101 0.1
102 0.1
103 0.1
104 0.09
105 0.08
106 0.06
107 0.04
108 0.04
109 0.04
110 0.04
111 0.03
112 0.04
113 0.04
114 0.04
115 0.08
116 0.13
117 0.15
118 0.16
119 0.17
120 0.19
121 0.2
122 0.2
123 0.16
124 0.15
125 0.15
126 0.17
127 0.17
128 0.15
129 0.14
130 0.14
131 0.13
132 0.09
133 0.08
134 0.04
135 0.03
136 0.03
137 0.04
138 0.05
139 0.08
140 0.1
141 0.1
142 0.12
143 0.17
144 0.17
145 0.18
146 0.21
147 0.26
148 0.34
149 0.36
150 0.41
151 0.46
152 0.5
153 0.51
154 0.48
155 0.42
156 0.33
157 0.33
158 0.27
159 0.19
160 0.14
161 0.15
162 0.17
163 0.17
164 0.19
165 0.19
166 0.2
167 0.23
168 0.3
169 0.3
170 0.33
171 0.43
172 0.52
173 0.6
174 0.68
175 0.72
176 0.76
177 0.84
178 0.85
179 0.81
180 0.8
181 0.75
182 0.66
183 0.6
184 0.49
185 0.43
186 0.35
187 0.29
188 0.2
189 0.2
190 0.21
191 0.25
192 0.33
193 0.34
194 0.42
195 0.48
196 0.54
197 0.59