Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F7ZIQ0

Protein Details
Accession A0A0F7ZIQ0   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
99-118VVLRFSKKIHFRKAREKLFVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 12.5, cyto 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001301  Gemini_AL1_CLV  
IPR022690  Gemini_AL1_REP_cat-dom  
IPR022692  Gemini_AL1_REP_central  
Gene Ontology GO:0003677  F:DNA binding  
GO:0016888  F:endodeoxyribonuclease activity, producing 5'-phosphomonoesters  
GO:0046872  F:metal ion binding  
GO:0005198  F:structural molecule activity  
GO:0006260  P:DNA replication  
Pfam View protein in Pfam  
PF00799  Gemini_AL1  
PF08283  Gemini_AL1_M  
Amino Acid Sequences MDDVRDVMSPGSDSGYETAEQGSCEPPGVLEEDEHFKLNAKMAFVTYSRSQMDDKEEFFKCLKESLADSLPRVSATKKVAVEIFGSKEVHQDGTPHYHVVLRFSKKIHFRKAREKLFVWIIKDGQRVVDTESIYIRKKPAWESPSKFLQDVQAYVAKDGDVFGEWIGTQAPTTAEQDSIVRRINETESREEAEALIREHFPKKWAWSQMNVQALLRTKKPPPPQLYVPDFKVLPWREPVKMKQWRERNFPVRGGGRPRALVIVGPPYCGKSYWARSWGRPAVMDGRWDLDQLLQSDVTHVVLNDIRLQDFPYKQELAGCQVSITVTGKYRAEMTIPWGKPCIWTCNEENSVLRDPQLGVYLKKAGAVIVKLSKKLYIERQEDTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.14
4 0.13
5 0.15
6 0.14
7 0.14
8 0.14
9 0.15
10 0.13
11 0.13
12 0.13
13 0.11
14 0.11
15 0.14
16 0.13
17 0.12
18 0.15
19 0.19
20 0.21
21 0.22
22 0.21
23 0.2
24 0.21
25 0.25
26 0.24
27 0.2
28 0.2
29 0.2
30 0.23
31 0.21
32 0.25
33 0.22
34 0.25
35 0.24
36 0.25
37 0.25
38 0.25
39 0.32
40 0.31
41 0.32
42 0.33
43 0.34
44 0.35
45 0.35
46 0.34
47 0.27
48 0.25
49 0.24
50 0.19
51 0.2
52 0.22
53 0.28
54 0.27
55 0.27
56 0.27
57 0.26
58 0.25
59 0.23
60 0.19
61 0.19
62 0.21
63 0.27
64 0.25
65 0.27
66 0.27
67 0.27
68 0.29
69 0.26
70 0.25
71 0.22
72 0.23
73 0.2
74 0.22
75 0.22
76 0.21
77 0.18
78 0.17
79 0.17
80 0.23
81 0.24
82 0.22
83 0.21
84 0.22
85 0.22
86 0.26
87 0.31
88 0.29
89 0.31
90 0.33
91 0.39
92 0.46
93 0.53
94 0.58
95 0.6
96 0.63
97 0.71
98 0.79
99 0.81
100 0.78
101 0.71
102 0.65
103 0.64
104 0.6
105 0.51
106 0.43
107 0.38
108 0.35
109 0.35
110 0.3
111 0.23
112 0.2
113 0.19
114 0.19
115 0.2
116 0.16
117 0.15
118 0.18
119 0.2
120 0.2
121 0.21
122 0.2
123 0.18
124 0.21
125 0.24
126 0.3
127 0.34
128 0.42
129 0.45
130 0.49
131 0.54
132 0.53
133 0.49
134 0.41
135 0.39
136 0.31
137 0.27
138 0.24
139 0.2
140 0.19
141 0.19
142 0.18
143 0.13
144 0.11
145 0.11
146 0.09
147 0.05
148 0.05
149 0.05
150 0.05
151 0.05
152 0.05
153 0.05
154 0.05
155 0.04
156 0.04
157 0.05
158 0.06
159 0.08
160 0.08
161 0.08
162 0.08
163 0.1
164 0.11
165 0.13
166 0.14
167 0.13
168 0.12
169 0.14
170 0.16
171 0.2
172 0.22
173 0.22
174 0.22
175 0.23
176 0.23
177 0.22
178 0.19
179 0.15
180 0.13
181 0.11
182 0.1
183 0.09
184 0.11
185 0.13
186 0.13
187 0.13
188 0.14
189 0.18
190 0.23
191 0.29
192 0.3
193 0.32
194 0.36
195 0.4
196 0.42
197 0.38
198 0.32
199 0.27
200 0.29
201 0.27
202 0.25
203 0.22
204 0.22
205 0.29
206 0.37
207 0.43
208 0.45
209 0.49
210 0.52
211 0.57
212 0.6
213 0.56
214 0.51
215 0.44
216 0.38
217 0.32
218 0.35
219 0.28
220 0.24
221 0.26
222 0.27
223 0.28
224 0.33
225 0.37
226 0.39
227 0.47
228 0.51
229 0.54
230 0.61
231 0.64
232 0.68
233 0.74
234 0.71
235 0.67
236 0.63
237 0.61
238 0.54
239 0.53
240 0.51
241 0.47
242 0.41
243 0.37
244 0.35
245 0.29
246 0.26
247 0.21
248 0.16
249 0.19
250 0.17
251 0.18
252 0.17
253 0.18
254 0.18
255 0.18
256 0.19
257 0.19
258 0.25
259 0.3
260 0.38
261 0.39
262 0.41
263 0.49
264 0.51
265 0.46
266 0.39
267 0.37
268 0.35
269 0.33
270 0.33
271 0.25
272 0.23
273 0.21
274 0.21
275 0.18
276 0.14
277 0.15
278 0.14
279 0.15
280 0.13
281 0.12
282 0.14
283 0.14
284 0.13
285 0.1
286 0.09
287 0.1
288 0.11
289 0.12
290 0.14
291 0.15
292 0.15
293 0.15
294 0.17
295 0.21
296 0.22
297 0.23
298 0.25
299 0.25
300 0.25
301 0.28
302 0.27
303 0.27
304 0.27
305 0.24
306 0.18
307 0.18
308 0.18
309 0.17
310 0.17
311 0.13
312 0.13
313 0.17
314 0.17
315 0.17
316 0.19
317 0.18
318 0.18
319 0.16
320 0.21
321 0.28
322 0.29
323 0.3
324 0.3
325 0.3
326 0.34
327 0.36
328 0.38
329 0.31
330 0.35
331 0.37
332 0.44
333 0.47
334 0.44
335 0.42
336 0.39
337 0.41
338 0.37
339 0.34
340 0.26
341 0.25
342 0.24
343 0.28
344 0.25
345 0.22
346 0.25
347 0.28
348 0.26
349 0.27
350 0.25
351 0.21
352 0.22
353 0.22
354 0.24
355 0.29
356 0.32
357 0.33
358 0.34
359 0.36
360 0.34
361 0.4
362 0.44
363 0.46
364 0.48