Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F8A606

Protein Details
Accession A0A0F8A606   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
3-49SAKKHVPIVKKRTTRFNRHQSDRFKCVAPSWRKPKGIDNRVRRRFRGHydrophilic
NLS Segment(s)
PositionSequence
36-37PK
Subcellular Location(s) mito 17.5, mito_nucl 12.833, nucl 7, cyto_nucl 5.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVSAKKHVPIVKKRTTRFNRHQSDRFKCVAPSWRKPKGIDNRVRRRFRGTMAMPSIGFGSNKKTRYMMPSGHKSFRVNNVKDVELLMMHNRTYAAEIASSVSSRKRIDIIARAKQLGVKVTNAKAKVTTEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.8
3 0.81
4 0.81
5 0.82
6 0.82
7 0.82
8 0.86
9 0.86
10 0.84
11 0.79
12 0.72
13 0.63
14 0.54
15 0.5
16 0.51
17 0.5
18 0.52
19 0.55
20 0.61
21 0.62
22 0.63
23 0.67
24 0.69
25 0.7
26 0.7
27 0.71
28 0.74
29 0.8
30 0.83
31 0.76
32 0.72
33 0.64
34 0.58
35 0.56
36 0.48
37 0.46
38 0.43
39 0.43
40 0.35
41 0.32
42 0.3
43 0.21
44 0.18
45 0.11
46 0.14
47 0.18
48 0.2
49 0.2
50 0.2
51 0.21
52 0.26
53 0.3
54 0.3
55 0.31
56 0.39
57 0.43
58 0.44
59 0.45
60 0.42
61 0.4
62 0.44
63 0.47
64 0.39
65 0.41
66 0.41
67 0.39
68 0.38
69 0.35
70 0.25
71 0.16
72 0.16
73 0.12
74 0.1
75 0.1
76 0.1
77 0.1
78 0.09
79 0.1
80 0.1
81 0.08
82 0.07
83 0.08
84 0.09
85 0.1
86 0.1
87 0.1
88 0.11
89 0.15
90 0.16
91 0.17
92 0.17
93 0.2
94 0.26
95 0.34
96 0.41
97 0.45
98 0.48
99 0.48
100 0.47
101 0.45
102 0.42
103 0.38
104 0.32
105 0.28
106 0.31
107 0.36
108 0.42
109 0.41
110 0.4
111 0.37