Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F7ZL09

Protein Details
Accession A0A0F7ZL09    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
232-253RSTLERFELKPKPQKARERTKSHydrophilic
NLS Segment(s)
PositionSequence
206-209KARK
242-251PKPQKARERT
Subcellular Location(s) mito 13, nucl 10, cyto 4
Family & Domain DBs
Amino Acid Sequences MVFVYQKRELTPRRPRWQASEAGHFVREINDYSSRIEKWIASCRSGTDADRALLLSVKIRSAGAEISDSVAKLADALDGHANLDIRLFETVWGANQRALVQSVEGDWLDRIVRLKGCRMEIASDKVRLERDPQDRAAADNINQKGRRASVITSHAGDKAGAAQVEKIARVLRELQGADSADLVSNHRFIWLRSRETAWKLWKAASKARKALRVANKGTRAIEKVDETASLLRSTLERFELKPKPQKARERTKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.78
3 0.77
4 0.75
5 0.74
6 0.68
7 0.67
8 0.62
9 0.56
10 0.52
11 0.44
12 0.38
13 0.31
14 0.27
15 0.19
16 0.19
17 0.2
18 0.21
19 0.23
20 0.27
21 0.25
22 0.25
23 0.25
24 0.23
25 0.24
26 0.33
27 0.33
28 0.31
29 0.31
30 0.31
31 0.34
32 0.34
33 0.3
34 0.25
35 0.25
36 0.23
37 0.23
38 0.21
39 0.17
40 0.16
41 0.15
42 0.14
43 0.12
44 0.12
45 0.12
46 0.12
47 0.12
48 0.12
49 0.12
50 0.09
51 0.09
52 0.09
53 0.1
54 0.11
55 0.1
56 0.09
57 0.09
58 0.07
59 0.06
60 0.06
61 0.05
62 0.05
63 0.06
64 0.08
65 0.08
66 0.08
67 0.09
68 0.09
69 0.08
70 0.08
71 0.07
72 0.06
73 0.07
74 0.07
75 0.06
76 0.07
77 0.07
78 0.08
79 0.1
80 0.1
81 0.1
82 0.11
83 0.11
84 0.11
85 0.12
86 0.1
87 0.08
88 0.08
89 0.08
90 0.08
91 0.07
92 0.07
93 0.05
94 0.06
95 0.06
96 0.07
97 0.07
98 0.08
99 0.11
100 0.12
101 0.16
102 0.18
103 0.19
104 0.2
105 0.19
106 0.2
107 0.2
108 0.25
109 0.23
110 0.22
111 0.21
112 0.22
113 0.22
114 0.2
115 0.21
116 0.24
117 0.26
118 0.28
119 0.28
120 0.29
121 0.28
122 0.29
123 0.27
124 0.2
125 0.17
126 0.2
127 0.21
128 0.25
129 0.25
130 0.25
131 0.24
132 0.24
133 0.23
134 0.18
135 0.18
136 0.18
137 0.22
138 0.23
139 0.23
140 0.23
141 0.22
142 0.2
143 0.19
144 0.13
145 0.1
146 0.1
147 0.09
148 0.08
149 0.08
150 0.1
151 0.1
152 0.1
153 0.1
154 0.1
155 0.1
156 0.11
157 0.14
158 0.13
159 0.17
160 0.17
161 0.16
162 0.18
163 0.18
164 0.17
165 0.14
166 0.13
167 0.1
168 0.1
169 0.11
170 0.09
171 0.1
172 0.09
173 0.12
174 0.12
175 0.12
176 0.22
177 0.26
178 0.3
179 0.31
180 0.36
181 0.39
182 0.42
183 0.49
184 0.46
185 0.46
186 0.43
187 0.45
188 0.46
189 0.45
190 0.5
191 0.52
192 0.53
193 0.55
194 0.59
195 0.61
196 0.59
197 0.64
198 0.65
199 0.66
200 0.65
201 0.66
202 0.65
203 0.62
204 0.61
205 0.56
206 0.48
207 0.42
208 0.39
209 0.33
210 0.29
211 0.27
212 0.24
213 0.22
214 0.22
215 0.21
216 0.17
217 0.15
218 0.14
219 0.14
220 0.16
221 0.16
222 0.18
223 0.19
224 0.22
225 0.31
226 0.39
227 0.46
228 0.54
229 0.6
230 0.66
231 0.73
232 0.82
233 0.83