Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9XN63

Protein Details
Accession A0A0C9XN63    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
63-94LKRPRWLVENRRRKRRWLPRYRLKRMKASELLBasic
NLS Segment(s)
PositionSequence
35-100RRIVRLPRKLLLQRELWKGRGKLKRRGPLKRPRWLVENRRRKRRWLPRYRLKRMKASELLRPRSKM
Subcellular Location(s) mito 20.5, mito_nucl 14, nucl 6.5
Family & Domain DBs
Amino Acid Sequences MTFPLSQLPPMLVPPYAQRNSKTMRPVCRTQSRQRRIVRLPRKLLLQRELWKGRGKLKRRGPLKRPRWLVENRRRKRRWLPRYRLKRMKASELLRPRSKMRNLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.26
3 0.29
4 0.32
5 0.32
6 0.36
7 0.41
8 0.46
9 0.5
10 0.47
11 0.52
12 0.56
13 0.6
14 0.63
15 0.68
16 0.7
17 0.71
18 0.76
19 0.74
20 0.76
21 0.76
22 0.75
23 0.74
24 0.77
25 0.76
26 0.75
27 0.73
28 0.66
29 0.67
30 0.63
31 0.59
32 0.52
33 0.49
34 0.45
35 0.48
36 0.48
37 0.43
38 0.43
39 0.41
40 0.46
41 0.47
42 0.48
43 0.49
44 0.56
45 0.61
46 0.65
47 0.73
48 0.74
49 0.76
50 0.8
51 0.8
52 0.77
53 0.72
54 0.7
55 0.7
56 0.72
57 0.72
58 0.74
59 0.74
60 0.78
61 0.78
62 0.79
63 0.8
64 0.8
65 0.81
66 0.81
67 0.83
68 0.83
69 0.92
70 0.94
71 0.93
72 0.88
73 0.87
74 0.82
75 0.8
76 0.78
77 0.71
78 0.7
79 0.7
80 0.73
81 0.7
82 0.68
83 0.64
84 0.64