Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9XMG9

Protein Details
Accession A0A0C9XMG9    Localization Confidence High Confidence Score 18.2
NoLS Segment(s)
PositionSequenceProtein Nature
50-80GNNPAPRINHPRRRNRPTKIRNRWNPAPRPIHydrophilic
100-125LAPPARRLPLRPTRPRPPRPHVDTQMHydrophilic
NLS Segment(s)
PositionSequence
56-75RINHPRRRNRPTKIRNRWNP
104-118ARRLPLRPTRPRPPR
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences LTTHTLLQTRRESAHPVPHQTRPPPLHQSPLTKIPTKPPENPQNHPSTHGNNPAPRINHPRRRNRPTKIRNRWNPAPRPIDEDPVPLSKPTPTLQPAKTLAPPARRLPLRPTRPRPPRPHVDTQM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.48
3 0.52
4 0.53
5 0.57
6 0.62
7 0.59
8 0.63
9 0.57
10 0.58
11 0.58
12 0.55
13 0.56
14 0.54
15 0.57
16 0.52
17 0.56
18 0.54
19 0.49
20 0.48
21 0.49
22 0.54
23 0.53
24 0.54
25 0.54
26 0.6
27 0.62
28 0.66
29 0.62
30 0.59
31 0.54
32 0.53
33 0.47
34 0.41
35 0.4
36 0.43
37 0.41
38 0.37
39 0.39
40 0.38
41 0.36
42 0.36
43 0.41
44 0.43
45 0.49
46 0.56
47 0.64
48 0.7
49 0.77
50 0.82
51 0.81
52 0.83
53 0.84
54 0.86
55 0.86
56 0.87
57 0.87
58 0.87
59 0.87
60 0.85
61 0.82
62 0.79
63 0.74
64 0.64
65 0.62
66 0.55
67 0.51
68 0.42
69 0.37
70 0.31
71 0.28
72 0.28
73 0.21
74 0.2
75 0.15
76 0.17
77 0.16
78 0.19
79 0.21
80 0.27
81 0.28
82 0.33
83 0.35
84 0.36
85 0.37
86 0.38
87 0.4
88 0.4
89 0.44
90 0.42
91 0.49
92 0.48
93 0.48
94 0.52
95 0.57
96 0.6
97 0.66
98 0.71
99 0.73
100 0.81
101 0.88
102 0.89
103 0.88
104 0.88
105 0.85