Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9X509

Protein Details
Accession A0A0C9X509    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
22-48YCGRECQKADWKKHRKWCKKDLDLTTPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR002893  Znf_MYND  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF01753  zf-MYND  
PROSITE View protein in PROSITE  
PS50865  ZF_MYND_2  
Amino Acid Sequences MKPEGSLLRCAGSCARIRKPRYCGRECQKADWKKHRKWCKKDLDLTTPSEADEAMLYNLHMTNDRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.38
3 0.44
4 0.5
5 0.55
6 0.62
7 0.66
8 0.69
9 0.68
10 0.69
11 0.68
12 0.73
13 0.68
14 0.67
15 0.68
16 0.67
17 0.7
18 0.71
19 0.73
20 0.7
21 0.77
22 0.8
23 0.81
24 0.82
25 0.83
26 0.83
27 0.83
28 0.84
29 0.81
30 0.79
31 0.72
32 0.67
33 0.59
34 0.48
35 0.39
36 0.31
37 0.23
38 0.15
39 0.12
40 0.09
41 0.07
42 0.07
43 0.07
44 0.08
45 0.09
46 0.1