Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9Y063

Protein Details
Accession A0A0C9Y063    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
76-101ACGGPHRCWHAKRRKKKLITISEQGHHydrophilic
NLS Segment(s)
PositionSequence
87-92KRRKKK
Subcellular Location(s) mito 16, cyto 5.5, cyto_nucl 4.5, nucl 2.5
Family & Domain DBs
Amino Acid Sequences MLHTGNTVRPLSHDTCVRILALGHLTSRRSCPGSWLWAVSNFVAFCPDWPPAVGPKIHIFCPDRDQGFPAIARGPACGGPHRCWHAKRRKKKLITISEQGHIILSSTKCVPVM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.32
3 0.32
4 0.3
5 0.24
6 0.21
7 0.19
8 0.17
9 0.15
10 0.14
11 0.15
12 0.17
13 0.18
14 0.2
15 0.21
16 0.21
17 0.2
18 0.23
19 0.25
20 0.29
21 0.29
22 0.29
23 0.26
24 0.26
25 0.27
26 0.22
27 0.2
28 0.14
29 0.13
30 0.12
31 0.11
32 0.09
33 0.1
34 0.11
35 0.09
36 0.1
37 0.11
38 0.11
39 0.13
40 0.13
41 0.12
42 0.16
43 0.17
44 0.17
45 0.21
46 0.21
47 0.2
48 0.24
49 0.26
50 0.23
51 0.22
52 0.23
53 0.2
54 0.2
55 0.18
56 0.15
57 0.12
58 0.12
59 0.12
60 0.11
61 0.11
62 0.11
63 0.12
64 0.17
65 0.2
66 0.22
67 0.28
68 0.33
69 0.38
70 0.41
71 0.5
72 0.56
73 0.62
74 0.7
75 0.76
76 0.81
77 0.83
78 0.88
79 0.88
80 0.88
81 0.85
82 0.83
83 0.76
84 0.68
85 0.6
86 0.51
87 0.41
88 0.3
89 0.22
90 0.19
91 0.15
92 0.16
93 0.17