Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9X9H3

Protein Details
Accession A0A0C9X9H3    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
6-26NSNSDKRNHWYRQRLHWKIKIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 13.666, nucl 13, mito 12, cyto_nucl 8.666
Family & Domain DBs
Amino Acid Sequences MIVKNNSNSDKRNHWYRQRLHWKIKITVCKSFPMLRNGGPPSFSLVGRTMSELTVNQRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.68
3 0.71
4 0.76
5 0.79
6 0.82
7 0.81
8 0.78
9 0.74
10 0.71
11 0.71
12 0.69
13 0.62
14 0.59
15 0.52
16 0.47
17 0.44
18 0.42
19 0.39
20 0.35
21 0.33
22 0.28
23 0.32
24 0.33
25 0.31
26 0.27
27 0.24
28 0.24
29 0.24
30 0.23
31 0.19
32 0.18
33 0.2
34 0.2
35 0.22
36 0.17
37 0.16
38 0.17
39 0.17