Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9X4B4

Protein Details
Accession A0A0C9X4B4    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
408-439DIILVKKTYPNQRKKNKARKWKLRSIAKEAGEHydrophilic
NLS Segment(s)
PositionSequence
419-433QRKKNKARKWKLRSI
Subcellular Location(s) nucl 14, cyto_nucl 13.333, cyto 11.5, mito_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR039768  Nmd3  
IPR007064  Nmd3_N  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0043023  F:ribosomal large subunit binding  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF04981  NMD3  
Amino Acid Sequences MEFTPGPAVHRVLCADCGTPIVPNTANLCVACLRNTVDITEGIPKQASVSFCRNCERFLSPPQAWTLAQPESRELLSICLKKLKGLNKVRLTDAHFIWTEPHSKRLRVAMTIQKEVLTNTILEQTFEIEYLVQHGQCPDCTKLAAKNTWKALVQVRQKVPHKRTFLYLEQLILKHNAQKDTISVKEVRDGLDFFYSSRSHALKMVEFLGSVVPIRSKASEQLLSSDTHTNTANFKYTYSVEIVPICKDDLVCIPLKQARQLSNISPLTVCVRVGNSIQLLDPATLQSCDIPSQLYWRTPFDSLASVTDLVEFTVLDIEPDRAKTRGKHIMADVQVALAGAFRSTGAKVDEDNGMMDYEDHGVTNQIYHTRTHLGAILQPGDAVLGYHLTNANYNSDDFASLPVGRIPDIILVKKTYPNQRKKNKARKWKLRSIAKEAGEEGETSGARGVVGRMGGRDQKKVEEDYELFLRDLEEDPEMRQGVNLYKAPEVKMAEPVLHEKKAGKRRGQNQYSMEVDDTPEERVPSTGVVVDGEDEEEDEAGFPDIALDELLEGLDEMTLGSGEHEEEERK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.21
3 0.2
4 0.21
5 0.18
6 0.18
7 0.17
8 0.19
9 0.18
10 0.19
11 0.22
12 0.22
13 0.24
14 0.21
15 0.22
16 0.21
17 0.22
18 0.21
19 0.2
20 0.2
21 0.22
22 0.23
23 0.22
24 0.2
25 0.2
26 0.2
27 0.25
28 0.23
29 0.2
30 0.2
31 0.19
32 0.19
33 0.22
34 0.23
35 0.21
36 0.3
37 0.33
38 0.36
39 0.44
40 0.44
41 0.42
42 0.44
43 0.43
44 0.39
45 0.43
46 0.48
47 0.41
48 0.43
49 0.44
50 0.43
51 0.38
52 0.35
53 0.32
54 0.29
55 0.3
56 0.28
57 0.28
58 0.27
59 0.27
60 0.25
61 0.21
62 0.2
63 0.25
64 0.27
65 0.27
66 0.31
67 0.31
68 0.34
69 0.4
70 0.44
71 0.46
72 0.52
73 0.6
74 0.62
75 0.65
76 0.64
77 0.63
78 0.61
79 0.56
80 0.47
81 0.42
82 0.34
83 0.31
84 0.3
85 0.28
86 0.3
87 0.26
88 0.33
89 0.32
90 0.34
91 0.37
92 0.41
93 0.42
94 0.38
95 0.44
96 0.44
97 0.46
98 0.48
99 0.45
100 0.39
101 0.36
102 0.33
103 0.27
104 0.19
105 0.13
106 0.11
107 0.16
108 0.15
109 0.15
110 0.15
111 0.15
112 0.14
113 0.14
114 0.13
115 0.07
116 0.07
117 0.11
118 0.12
119 0.1
120 0.11
121 0.13
122 0.14
123 0.15
124 0.19
125 0.18
126 0.17
127 0.18
128 0.2
129 0.24
130 0.29
131 0.35
132 0.37
133 0.41
134 0.43
135 0.45
136 0.43
137 0.41
138 0.41
139 0.41
140 0.44
141 0.47
142 0.48
143 0.54
144 0.61
145 0.68
146 0.68
147 0.68
148 0.66
149 0.59
150 0.59
151 0.57
152 0.54
153 0.5
154 0.44
155 0.38
156 0.34
157 0.33
158 0.29
159 0.25
160 0.22
161 0.2
162 0.23
163 0.22
164 0.2
165 0.2
166 0.22
167 0.25
168 0.25
169 0.24
170 0.23
171 0.21
172 0.25
173 0.25
174 0.23
175 0.2
176 0.19
177 0.17
178 0.17
179 0.17
180 0.13
181 0.15
182 0.14
183 0.13
184 0.17
185 0.16
186 0.15
187 0.18
188 0.2
189 0.17
190 0.19
191 0.19
192 0.15
193 0.14
194 0.14
195 0.1
196 0.09
197 0.08
198 0.06
199 0.06
200 0.06
201 0.07
202 0.08
203 0.09
204 0.11
205 0.15
206 0.18
207 0.18
208 0.2
209 0.21
210 0.2
211 0.22
212 0.23
213 0.19
214 0.18
215 0.18
216 0.16
217 0.17
218 0.18
219 0.18
220 0.14
221 0.14
222 0.15
223 0.16
224 0.16
225 0.16
226 0.16
227 0.14
228 0.16
229 0.16
230 0.14
231 0.14
232 0.12
233 0.1
234 0.09
235 0.09
236 0.09
237 0.1
238 0.11
239 0.1
240 0.13
241 0.16
242 0.16
243 0.19
244 0.21
245 0.21
246 0.24
247 0.26
248 0.25
249 0.3
250 0.3
251 0.27
252 0.23
253 0.21
254 0.19
255 0.17
256 0.16
257 0.08
258 0.09
259 0.09
260 0.1
261 0.1
262 0.08
263 0.08
264 0.08
265 0.08
266 0.08
267 0.07
268 0.07
269 0.06
270 0.06
271 0.06
272 0.06
273 0.05
274 0.05
275 0.06
276 0.06
277 0.06
278 0.06
279 0.1
280 0.12
281 0.14
282 0.15
283 0.16
284 0.18
285 0.18
286 0.18
287 0.16
288 0.15
289 0.14
290 0.13
291 0.12
292 0.11
293 0.1
294 0.1
295 0.09
296 0.07
297 0.06
298 0.05
299 0.04
300 0.05
301 0.04
302 0.04
303 0.05
304 0.06
305 0.06
306 0.08
307 0.1
308 0.1
309 0.12
310 0.15
311 0.21
312 0.29
313 0.3
314 0.31
315 0.32
316 0.37
317 0.36
318 0.35
319 0.28
320 0.18
321 0.17
322 0.14
323 0.12
324 0.06
325 0.05
326 0.03
327 0.03
328 0.03
329 0.04
330 0.05
331 0.06
332 0.07
333 0.08
334 0.08
335 0.1
336 0.11
337 0.11
338 0.11
339 0.1
340 0.09
341 0.08
342 0.08
343 0.07
344 0.07
345 0.07
346 0.06
347 0.06
348 0.07
349 0.07
350 0.07
351 0.08
352 0.1
353 0.11
354 0.11
355 0.14
356 0.16
357 0.16
358 0.16
359 0.17
360 0.14
361 0.16
362 0.17
363 0.16
364 0.13
365 0.13
366 0.12
367 0.09
368 0.09
369 0.06
370 0.04
371 0.04
372 0.04
373 0.06
374 0.07
375 0.07
376 0.1
377 0.1
378 0.12
379 0.12
380 0.12
381 0.12
382 0.11
383 0.12
384 0.1
385 0.1
386 0.11
387 0.1
388 0.1
389 0.1
390 0.1
391 0.1
392 0.1
393 0.09
394 0.12
395 0.14
396 0.15
397 0.16
398 0.17
399 0.19
400 0.23
401 0.29
402 0.35
403 0.43
404 0.52
405 0.61
406 0.69
407 0.79
408 0.86
409 0.91
410 0.9
411 0.92
412 0.92
413 0.93
414 0.93
415 0.92
416 0.9
417 0.89
418 0.86
419 0.84
420 0.81
421 0.72
422 0.64
423 0.55
424 0.47
425 0.37
426 0.3
427 0.21
428 0.16
429 0.13
430 0.11
431 0.11
432 0.09
433 0.08
434 0.08
435 0.08
436 0.07
437 0.08
438 0.09
439 0.09
440 0.13
441 0.21
442 0.23
443 0.27
444 0.28
445 0.31
446 0.35
447 0.36
448 0.34
449 0.34
450 0.33
451 0.32
452 0.33
453 0.29
454 0.26
455 0.23
456 0.22
457 0.16
458 0.16
459 0.14
460 0.13
461 0.12
462 0.13
463 0.17
464 0.17
465 0.15
466 0.15
467 0.15
468 0.17
469 0.22
470 0.23
471 0.22
472 0.25
473 0.28
474 0.28
475 0.31
476 0.3
477 0.26
478 0.29
479 0.28
480 0.25
481 0.25
482 0.32
483 0.32
484 0.31
485 0.31
486 0.31
487 0.39
488 0.47
489 0.54
490 0.55
491 0.59
492 0.69
493 0.78
494 0.8
495 0.79
496 0.74
497 0.71
498 0.65
499 0.58
500 0.49
501 0.38
502 0.33
503 0.27
504 0.24
505 0.2
506 0.19
507 0.17
508 0.17
509 0.17
510 0.16
511 0.14
512 0.15
513 0.13
514 0.12
515 0.11
516 0.11
517 0.11
518 0.11
519 0.1
520 0.09
521 0.08
522 0.08
523 0.07
524 0.07
525 0.07
526 0.07
527 0.07
528 0.07
529 0.06
530 0.07
531 0.07
532 0.07
533 0.06
534 0.06
535 0.05
536 0.05
537 0.05
538 0.05
539 0.04
540 0.04
541 0.04
542 0.04
543 0.04
544 0.04
545 0.04
546 0.04
547 0.05
548 0.06
549 0.06
550 0.08