Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9XE98

Protein Details
Accession A0A0C9XE98    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
12-40TARNTHRPSRPTTRPKKRTEKVAKNHVVHHydrophilic
NLS Segment(s)
PositionSequence
22-29PTTRPKKR
Subcellular Location(s) mito 16, nucl 8.5, cyto_nucl 6
Family & Domain DBs
Amino Acid Sequences MTTVSFASSVNTARNTHRPSRPTTRPKKRTEKVAKNHVVHDLAQYINNPTHRGTTPWKQYFNLASGTKLSKVYTTRADLHLVHCSHVPLRESLWYTFTQGQAWQTLQLMEEMPHEQEEVENVTGPGKPAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.39
3 0.45
4 0.51
5 0.52
6 0.57
7 0.65
8 0.7
9 0.72
10 0.77
11 0.8
12 0.82
13 0.88
14 0.91
15 0.87
16 0.87
17 0.88
18 0.87
19 0.85
20 0.87
21 0.85
22 0.77
23 0.73
24 0.66
25 0.56
26 0.46
27 0.38
28 0.29
29 0.2
30 0.18
31 0.17
32 0.15
33 0.15
34 0.16
35 0.16
36 0.14
37 0.17
38 0.16
39 0.19
40 0.23
41 0.29
42 0.38
43 0.42
44 0.44
45 0.41
46 0.43
47 0.41
48 0.37
49 0.34
50 0.24
51 0.19
52 0.19
53 0.19
54 0.18
55 0.17
56 0.15
57 0.13
58 0.14
59 0.16
60 0.18
61 0.21
62 0.22
63 0.23
64 0.26
65 0.24
66 0.24
67 0.28
68 0.24
69 0.22
70 0.2
71 0.19
72 0.18
73 0.2
74 0.19
75 0.13
76 0.14
77 0.17
78 0.2
79 0.19
80 0.21
81 0.18
82 0.21
83 0.23
84 0.22
85 0.2
86 0.18
87 0.19
88 0.19
89 0.19
90 0.16
91 0.14
92 0.14
93 0.13
94 0.12
95 0.12
96 0.1
97 0.11
98 0.12
99 0.12
100 0.12
101 0.12
102 0.11
103 0.1
104 0.12
105 0.14
106 0.13
107 0.13
108 0.13
109 0.14
110 0.15