Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9XBU5

Protein Details
Accession A0A0C9XBU5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
47-66FTGQRKRTKKTSQLMLKRNSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 8, cyto 5
Family & Domain DBs
Amino Acid Sequences MVRERVVTRDARWGLREIAWERCKLKSKSRVGESRQAFGERGEDEGFTGQRKRTKKTSQLMLKRNSYVETKNKGGSACLLAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.33
3 0.37
4 0.3
5 0.36
6 0.36
7 0.38
8 0.37
9 0.4
10 0.47
11 0.45
12 0.52
13 0.52
14 0.58
15 0.62
16 0.68
17 0.71
18 0.67
19 0.72
20 0.65
21 0.58
22 0.5
23 0.43
24 0.35
25 0.27
26 0.24
27 0.15
28 0.15
29 0.12
30 0.1
31 0.09
32 0.1
33 0.1
34 0.1
35 0.12
36 0.13
37 0.19
38 0.23
39 0.28
40 0.36
41 0.44
42 0.52
43 0.58
44 0.66
45 0.7
46 0.76
47 0.8
48 0.78
49 0.74
50 0.67
51 0.6
52 0.53
53 0.47
54 0.44
55 0.45
56 0.44
57 0.43
58 0.43
59 0.44
60 0.42
61 0.39
62 0.35