Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9X1S3

Protein Details
Accession A0A0C9X1S3    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
102-125GTSTSSQKPQAPPRRKQRVSEAPSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, mito_nucl 12.333, cyto_nucl 11.833, mito 4.5
Family & Domain DBs
Amino Acid Sequences MRNWYMNMAPWDRPRECEAWLPDFLGDKKFFDEDDTISAGFYFPGTPRRTLDFYRTLNFTKRRSAPDTTVLPALTKRMKPTPRLSVIPSDSVRDSAEAAPNGTSTSSQKPQAPPRRKQRVSEAPSRKVEDLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.41
3 0.4
4 0.42
5 0.4
6 0.37
7 0.36
8 0.33
9 0.29
10 0.32
11 0.3
12 0.27
13 0.23
14 0.2
15 0.21
16 0.21
17 0.2
18 0.19
19 0.2
20 0.16
21 0.17
22 0.18
23 0.15
24 0.15
25 0.14
26 0.11
27 0.09
28 0.08
29 0.06
30 0.06
31 0.13
32 0.16
33 0.17
34 0.19
35 0.24
36 0.27
37 0.28
38 0.33
39 0.33
40 0.34
41 0.34
42 0.35
43 0.33
44 0.37
45 0.4
46 0.37
47 0.36
48 0.38
49 0.41
50 0.42
51 0.44
52 0.39
53 0.4
54 0.4
55 0.34
56 0.31
57 0.26
58 0.22
59 0.18
60 0.19
61 0.17
62 0.16
63 0.18
64 0.25
65 0.29
66 0.35
67 0.41
68 0.46
69 0.47
70 0.49
71 0.48
72 0.46
73 0.45
74 0.44
75 0.38
76 0.32
77 0.28
78 0.26
79 0.24
80 0.18
81 0.17
82 0.14
83 0.17
84 0.15
85 0.16
86 0.15
87 0.15
88 0.15
89 0.13
90 0.12
91 0.11
92 0.18
93 0.21
94 0.25
95 0.3
96 0.37
97 0.48
98 0.58
99 0.64
100 0.67
101 0.74
102 0.82
103 0.81
104 0.8
105 0.8
106 0.8
107 0.78
108 0.79
109 0.77
110 0.74
111 0.76
112 0.75