Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9WWG9

Protein Details
Accession A0A0C9WWG9    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
26-45TGHVIRIRRRRKPTGFSVRRBasic
NLS Segment(s)
PositionSequence
32-38IRRRRKP
Subcellular Location(s) nucl 20.5, cyto_nucl 14.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021109  Peptidase_aspartic_dom_sf  
CDD cd00303  retropepsin_like  
Amino Acid Sequences MDIDRLTINERDQYMKEGKCFRCGKTGHVIRIRRRRKPTGFSVRRLVTTSRPSKPLSIRSIRIRSVPGSDTKSMHVKTRIINGEKSVEIKALIDSGAQGNFMDEEFTKKHRIPIVRLKKEIRVSNVDESPNKSGPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.35
3 0.39
4 0.43
5 0.43
6 0.49
7 0.52
8 0.48
9 0.49
10 0.48
11 0.46
12 0.48
13 0.53
14 0.52
15 0.57
16 0.63
17 0.64
18 0.74
19 0.78
20 0.77
21 0.78
22 0.8
23 0.79
24 0.79
25 0.8
26 0.81
27 0.79
28 0.75
29 0.74
30 0.66
31 0.59
32 0.54
33 0.45
34 0.4
35 0.41
36 0.43
37 0.38
38 0.4
39 0.4
40 0.42
41 0.45
42 0.46
43 0.44
44 0.43
45 0.45
46 0.49
47 0.52
48 0.48
49 0.45
50 0.4
51 0.33
52 0.3
53 0.27
54 0.23
55 0.22
56 0.22
57 0.22
58 0.22
59 0.26
60 0.24
61 0.26
62 0.25
63 0.24
64 0.24
65 0.31
66 0.35
67 0.33
68 0.33
69 0.31
70 0.31
71 0.29
72 0.28
73 0.21
74 0.15
75 0.13
76 0.12
77 0.1
78 0.08
79 0.08
80 0.06
81 0.06
82 0.07
83 0.07
84 0.07
85 0.06
86 0.06
87 0.07
88 0.07
89 0.07
90 0.06
91 0.1
92 0.12
93 0.15
94 0.2
95 0.21
96 0.26
97 0.31
98 0.37
99 0.41
100 0.5
101 0.59
102 0.63
103 0.68
104 0.67
105 0.69
106 0.72
107 0.7
108 0.65
109 0.61
110 0.57
111 0.58
112 0.59
113 0.56
114 0.52
115 0.5
116 0.5