Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9WRP3

Protein Details
Accession A0A0C9WRP3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
73-92EARREICHLRRQRCKTFGKEBasic
NLS Segment(s)
Subcellular Location(s) cyto 13, cyto_nucl 8.5, mito 8, cysk 4
Family & Domain DBs
Amino Acid Sequences MVSDKDQISVPADTTDGAKLVRKAGVMILMIWRSKRAFSTKFRSICNKRAAIVSSPVPIQVNVFKILLLPVGEARREICHLRRQRCKTFGKEVRYLPPYDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.11
4 0.11
5 0.13
6 0.13
7 0.15
8 0.17
9 0.15
10 0.15
11 0.15
12 0.17
13 0.13
14 0.13
15 0.14
16 0.14
17 0.15
18 0.14
19 0.16
20 0.14
21 0.14
22 0.17
23 0.21
24 0.25
25 0.32
26 0.4
27 0.46
28 0.49
29 0.51
30 0.58
31 0.57
32 0.59
33 0.58
34 0.51
35 0.44
36 0.42
37 0.41
38 0.33
39 0.3
40 0.23
41 0.17
42 0.16
43 0.16
44 0.14
45 0.12
46 0.11
47 0.11
48 0.12
49 0.12
50 0.12
51 0.11
52 0.11
53 0.11
54 0.11
55 0.08
56 0.07
57 0.09
58 0.1
59 0.11
60 0.11
61 0.12
62 0.13
63 0.16
64 0.2
65 0.22
66 0.3
67 0.39
68 0.49
69 0.58
70 0.65
71 0.72
72 0.77
73 0.8
74 0.78
75 0.8
76 0.79
77 0.76
78 0.75
79 0.7
80 0.71
81 0.66