Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9XQQ3

Protein Details
Accession A0A0C9XQQ3    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
3-28RFPPSSCRTRPHQGCRRKRRCVMSALHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 11.5, mito 6
Family & Domain DBs
Amino Acid Sequences MERFPPSSCRTRPHQGCRRKRRCVMSALSPCRLMFYYALSSEPFHGYPKIVHLIDNTKTSFCVCVIDKNEVLLIHGYSMRASENLPIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.75
3 0.82
4 0.88
5 0.91
6 0.9
7 0.88
8 0.86
9 0.81
10 0.79
11 0.73
12 0.72
13 0.72
14 0.67
15 0.61
16 0.53
17 0.47
18 0.41
19 0.36
20 0.27
21 0.17
22 0.14
23 0.14
24 0.13
25 0.15
26 0.13
27 0.13
28 0.13
29 0.14
30 0.12
31 0.1
32 0.1
33 0.1
34 0.1
35 0.12
36 0.15
37 0.14
38 0.14
39 0.15
40 0.19
41 0.21
42 0.24
43 0.22
44 0.18
45 0.18
46 0.18
47 0.17
48 0.13
49 0.14
50 0.12
51 0.19
52 0.21
53 0.26
54 0.25
55 0.25
56 0.27
57 0.22
58 0.23
59 0.17
60 0.14
61 0.11
62 0.12
63 0.12
64 0.1
65 0.11
66 0.11
67 0.1
68 0.11