Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9X7P2

Protein Details
Accession A0A0C9X7P2    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
8-38SSSYIPCPTNKKRLNPRRRRLRSRSSRIVVIHydrophilic
NLS Segment(s)
PositionSequence
18-31KKRLNPRRRRLRSR
Subcellular Location(s) nucl 18, cyto_nucl 11.5, mito 6
Family & Domain DBs
Amino Acid Sequences LSAGPSRSSSYIPCPTNKKRLNPRRRRLRSRSSRIVVIVEELQFNFDIELGLEEGEKSDVVSQCLDQSFSSPFALGIHSSSKRSAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.52
3 0.61
4 0.65
5 0.67
6 0.7
7 0.78
8 0.83
9 0.85
10 0.89
11 0.89
12 0.93
13 0.94
14 0.91
15 0.91
16 0.91
17 0.9
18 0.89
19 0.81
20 0.73
21 0.63
22 0.55
23 0.44
24 0.35
25 0.27
26 0.17
27 0.14
28 0.11
29 0.1
30 0.09
31 0.09
32 0.07
33 0.05
34 0.04
35 0.04
36 0.05
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.05
43 0.05
44 0.04
45 0.08
46 0.09
47 0.1
48 0.11
49 0.11
50 0.14
51 0.15
52 0.16
53 0.12
54 0.13
55 0.14
56 0.15
57 0.15
58 0.13
59 0.12
60 0.12
61 0.13
62 0.12
63 0.12
64 0.17
65 0.19
66 0.21