Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9X8R4

Protein Details
Accession A0A0C9X8R4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
58-77GYTVAKENKKKAQKARLRTAHydrophilic
NLS Segment(s)
PositionSequence
66-73KKKAQKAR
Subcellular Location(s) mito 8, plas 6, cyto_mito 6, cyto 4, extr 4, mito_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MLLAAYIVFTYYTAWALLLPFFPKSSPIHDWFPSREWAIRLPAVLLVLGLSAIGIFVGYTVAKENKKKAQKARLRTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.08
4 0.08
5 0.09
6 0.09
7 0.09
8 0.1
9 0.1
10 0.12
11 0.13
12 0.19
13 0.23
14 0.26
15 0.3
16 0.32
17 0.35
18 0.34
19 0.35
20 0.31
21 0.27
22 0.25
23 0.21
24 0.21
25 0.2
26 0.18
27 0.16
28 0.14
29 0.13
30 0.11
31 0.09
32 0.07
33 0.04
34 0.04
35 0.03
36 0.03
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.02
43 0.02
44 0.03
45 0.03
46 0.04
47 0.07
48 0.13
49 0.18
50 0.23
51 0.3
52 0.39
53 0.48
54 0.57
55 0.64
56 0.7
57 0.75