Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q4WWM6

Protein Details
Accession Q4WWM6    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
260-285PPDLREIRKLMRQQQKREKERLQGKSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18.5, cyto_mito 11.5, cyto 3.5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007715  Coq4  
IPR027540  Coq4_euk  
Gene Ontology GO:0031314  C:extrinsic component of mitochondrial inner membrane  
GO:0005739  C:mitochondrion  
GO:0006744  P:ubiquinone biosynthetic process  
KEGG afm:AFUA_3G06410  -  
Pfam View protein in Pfam  
PF05019  Coq4  
Amino Acid Sequences MSVLGRRGAGLAARGATLAPLATASYLIRPFSALNRPPPKYPGHVPLTFFERGALAVGSAVGSLMNPRRADLIAALGEATATPYFIYRLRDAMLSDPTGRRILRDRPRITSETLKLPYLRTLPENSVGRTYATWLDREGVSPDTRNSVKYIDDEECAYVMQRYRECHDFYHAVTGLPTFVEGELALKAFEFLNTLIPMTGLSIFAFVRLKPAERERFFSLHLPWAVRSGLASKELINVYWEEILEKDVDELRKELGIERPPDLREIRKLMRQQQKREKERLQGKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.11
4 0.1
5 0.08
6 0.06
7 0.05
8 0.05
9 0.05
10 0.06
11 0.07
12 0.11
13 0.13
14 0.13
15 0.13
16 0.14
17 0.15
18 0.2
19 0.29
20 0.3
21 0.38
22 0.47
23 0.5
24 0.52
25 0.55
26 0.55
27 0.51
28 0.53
29 0.51
30 0.49
31 0.5
32 0.49
33 0.48
34 0.49
35 0.43
36 0.36
37 0.28
38 0.21
39 0.17
40 0.16
41 0.13
42 0.07
43 0.06
44 0.06
45 0.06
46 0.05
47 0.05
48 0.03
49 0.03
50 0.07
51 0.11
52 0.16
53 0.16
54 0.16
55 0.18
56 0.19
57 0.2
58 0.17
59 0.17
60 0.12
61 0.12
62 0.11
63 0.09
64 0.09
65 0.08
66 0.08
67 0.05
68 0.05
69 0.05
70 0.05
71 0.07
72 0.09
73 0.13
74 0.13
75 0.14
76 0.15
77 0.16
78 0.16
79 0.18
80 0.18
81 0.16
82 0.18
83 0.17
84 0.18
85 0.21
86 0.2
87 0.19
88 0.22
89 0.3
90 0.37
91 0.47
92 0.48
93 0.5
94 0.56
95 0.56
96 0.55
97 0.52
98 0.45
99 0.42
100 0.41
101 0.37
102 0.32
103 0.3
104 0.29
105 0.24
106 0.22
107 0.17
108 0.18
109 0.18
110 0.24
111 0.25
112 0.22
113 0.22
114 0.21
115 0.19
116 0.17
117 0.17
118 0.15
119 0.14
120 0.13
121 0.12
122 0.13
123 0.13
124 0.14
125 0.14
126 0.11
127 0.11
128 0.12
129 0.12
130 0.14
131 0.14
132 0.14
133 0.14
134 0.13
135 0.13
136 0.14
137 0.17
138 0.14
139 0.14
140 0.14
141 0.13
142 0.12
143 0.11
144 0.1
145 0.08
146 0.09
147 0.11
148 0.13
149 0.14
150 0.18
151 0.22
152 0.23
153 0.23
154 0.26
155 0.25
156 0.23
157 0.27
158 0.24
159 0.2
160 0.19
161 0.18
162 0.13
163 0.11
164 0.11
165 0.05
166 0.04
167 0.04
168 0.04
169 0.05
170 0.05
171 0.05
172 0.05
173 0.04
174 0.05
175 0.05
176 0.05
177 0.05
178 0.06
179 0.08
180 0.09
181 0.09
182 0.08
183 0.08
184 0.08
185 0.08
186 0.08
187 0.06
188 0.05
189 0.07
190 0.06
191 0.08
192 0.09
193 0.08
194 0.13
195 0.13
196 0.15
197 0.19
198 0.28
199 0.36
200 0.38
201 0.43
202 0.43
203 0.45
204 0.45
205 0.45
206 0.38
207 0.35
208 0.35
209 0.31
210 0.27
211 0.27
212 0.24
213 0.2
214 0.18
215 0.14
216 0.14
217 0.14
218 0.15
219 0.13
220 0.17
221 0.18
222 0.17
223 0.16
224 0.15
225 0.14
226 0.15
227 0.14
228 0.11
229 0.11
230 0.11
231 0.1
232 0.1
233 0.1
234 0.13
235 0.15
236 0.16
237 0.17
238 0.17
239 0.18
240 0.18
241 0.2
242 0.23
243 0.28
244 0.29
245 0.31
246 0.34
247 0.33
248 0.38
249 0.39
250 0.38
251 0.38
252 0.43
253 0.47
254 0.5
255 0.58
256 0.63
257 0.69
258 0.73
259 0.77
260 0.8
261 0.85
262 0.86
263 0.88
264 0.85
265 0.85