Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9X1Q2

Protein Details
Accession A0A0C9X1Q2    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
52-71GFRPWKREPKTKQPKVKISDBasic
NLS Segment(s)
Subcellular Location(s) mito 9, cyto_nucl 8, nucl 7, cyto 7, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001192  PI-PLC_fam  
IPR017946  PLC-like_Pdiesterase_TIM-brl  
IPR001711  PLipase_C_Pinositol-sp_Y  
Gene Ontology GO:0004435  F:phosphatidylinositol phospholipase C activity  
GO:0035556  P:intracellular signal transduction  
GO:0016042  P:lipid catabolic process  
Pfam View protein in Pfam  
PF00387  PI-PLC-Y  
PROSITE View protein in PROSITE  
PS50008  PIPLC_Y_DOMAIN  
Amino Acid Sequences MSVMKVTWGDKLVVGRIEGVRDGMGRSGVNQDGNECPDEQNPQPVKGQGGDGFRPWKREPKTKQPKVKISDELAELGYYARSLKLRKGWPDQPLTSPPHILINISETSLSSLLPISLLPLIALASQHLRRVYPRGTRTQSSNFSPELYWRSGTQVAPLNSELAEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.2
4 0.2
5 0.18
6 0.17
7 0.14
8 0.13
9 0.14
10 0.11
11 0.12
12 0.1
13 0.11
14 0.14
15 0.15
16 0.17
17 0.16
18 0.17
19 0.18
20 0.2
21 0.2
22 0.18
23 0.17
24 0.17
25 0.21
26 0.2
27 0.27
28 0.27
29 0.28
30 0.29
31 0.29
32 0.29
33 0.25
34 0.27
35 0.21
36 0.23
37 0.22
38 0.23
39 0.28
40 0.28
41 0.32
42 0.32
43 0.37
44 0.38
45 0.47
46 0.52
47 0.57
48 0.68
49 0.72
50 0.8
51 0.8
52 0.83
53 0.79
54 0.77
55 0.7
56 0.61
57 0.54
58 0.45
59 0.37
60 0.28
61 0.22
62 0.16
63 0.11
64 0.08
65 0.06
66 0.05
67 0.05
68 0.07
69 0.08
70 0.11
71 0.17
72 0.22
73 0.28
74 0.34
75 0.39
76 0.42
77 0.47
78 0.46
79 0.42
80 0.43
81 0.41
82 0.36
83 0.31
84 0.26
85 0.23
86 0.22
87 0.18
88 0.14
89 0.13
90 0.12
91 0.12
92 0.11
93 0.08
94 0.1
95 0.1
96 0.09
97 0.06
98 0.06
99 0.05
100 0.06
101 0.05
102 0.05
103 0.05
104 0.05
105 0.05
106 0.05
107 0.05
108 0.05
109 0.05
110 0.05
111 0.1
112 0.11
113 0.14
114 0.15
115 0.16
116 0.18
117 0.24
118 0.3
119 0.34
120 0.39
121 0.46
122 0.51
123 0.54
124 0.58
125 0.6
126 0.59
127 0.55
128 0.54
129 0.45
130 0.4
131 0.37
132 0.36
133 0.33
134 0.3
135 0.27
136 0.23
137 0.27
138 0.3
139 0.29
140 0.3
141 0.33
142 0.31
143 0.33
144 0.33
145 0.29