Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9WRU4

Protein Details
Accession A0A0C9WRU4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
88-109QPQGGPPRSGPKRMRRRAIKVAHydrophilic
NLS Segment(s)
PositionSequence
76-109PPPPPPQPPKRSQPQGGPPRSGPKRMRRRAIKVA
Subcellular Location(s) extr 11, plas 6, E.R. 4, mito 3, golg 2, mito_nucl 2
Family & Domain DBs
Amino Acid Sequences MRFSSTLALIALVLGVTSMAHPLGTYPDLTERDDKYIEFEARMFDIDQLEPRRNSHENSLHDIIMGPWPSPPPLPPPPPPPQPPKRSQPQGGPPRSGPKRMRRRAIKVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.04
6 0.04
7 0.04
8 0.04
9 0.05
10 0.08
11 0.09
12 0.09
13 0.09
14 0.14
15 0.16
16 0.19
17 0.23
18 0.21
19 0.23
20 0.24
21 0.23
22 0.21
23 0.24
24 0.23
25 0.19
26 0.18
27 0.16
28 0.16
29 0.16
30 0.13
31 0.09
32 0.1
33 0.09
34 0.14
35 0.16
36 0.18
37 0.18
38 0.18
39 0.23
40 0.23
41 0.24
42 0.27
43 0.31
44 0.31
45 0.37
46 0.38
47 0.32
48 0.3
49 0.29
50 0.23
51 0.19
52 0.16
53 0.1
54 0.09
55 0.09
56 0.1
57 0.11
58 0.11
59 0.15
60 0.22
61 0.27
62 0.32
63 0.39
64 0.45
65 0.52
66 0.58
67 0.61
68 0.63
69 0.66
70 0.69
71 0.7
72 0.73
73 0.74
74 0.73
75 0.73
76 0.74
77 0.76
78 0.75
79 0.71
80 0.65
81 0.67
82 0.66
83 0.66
84 0.64
85 0.64
86 0.7
87 0.75
88 0.82
89 0.81