Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9WTC7

Protein Details
Accession A0A0C9WTC7    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
22-44WSKQPFQYHRSKRHPKAQSPPSFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 6, cyto_nucl 5
Family & Domain DBs
Amino Acid Sequences MKVVAVSTPETRTPSRPTSLFWSKQPFQYHRSKRHPKAQSPPSFEHPFSHLQLSKDGGAAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.37
3 0.35
4 0.36
5 0.4
6 0.47
7 0.46
8 0.44
9 0.48
10 0.45
11 0.5
12 0.53
13 0.48
14 0.45
15 0.52
16 0.56
17 0.58
18 0.67
19 0.71
20 0.71
21 0.78
22 0.81
23 0.78
24 0.8
25 0.8
26 0.79
27 0.76
28 0.73
29 0.71
30 0.67
31 0.6
32 0.52
33 0.45
34 0.41
35 0.36
36 0.38
37 0.34
38 0.31
39 0.33
40 0.34
41 0.31