Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9X296

Protein Details
Accession A0A0C9X296    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
23-50YCGRECQKADWKKHRKWCKKDLDLPTPSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16.5, mito_nucl 14, nucl 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002893  Znf_MYND  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF01753  zf-MYND  
PROSITE View protein in PROSITE  
PS50865  ZF_MYND_2  
Amino Acid Sequences MMKPEGSLLRCAGSCARIRKPRYCGRECQKADWKKHRKWCKKDLDLPTPSEADEAMLYNMHMTNDSSSQSRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.3
3 0.38
4 0.44
5 0.5
6 0.55
7 0.62
8 0.66
9 0.69
10 0.68
11 0.69
12 0.68
13 0.73
14 0.68
15 0.68
16 0.68
17 0.67
18 0.71
19 0.72
20 0.74
21 0.7
22 0.78
23 0.81
24 0.81
25 0.82
26 0.83
27 0.83
28 0.82
29 0.84
30 0.83
31 0.81
32 0.74
33 0.68
34 0.6
35 0.5
36 0.41
37 0.32
38 0.23
39 0.14
40 0.11
41 0.1
42 0.08
43 0.07
44 0.07
45 0.08
46 0.09
47 0.08
48 0.09
49 0.09
50 0.11
51 0.13
52 0.15