Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9XKC1

Protein Details
Accession A0A0C9XKC1    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
21-47PKSKGIGRRAAKFKRRKPRDDGRSKFIBasic
NLS Segment(s)
PositionSequence
20-40PPKSKGIGRRAAKFKRRKPRD
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
Amino Acid Sequences MLRAPKCSGRQRGPSMDSEPPKSKGIGRRAAKFKRRKPRDDGRSKFICTHSTLYCNSTDKKKLQELYSHFLRQTCEDGFRELSYCYSARSSRTYLMSHDRSLHLVAYKLTARTFVEAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.63
3 0.62
4 0.58
5 0.56
6 0.53
7 0.48
8 0.46
9 0.42
10 0.42
11 0.42
12 0.46
13 0.49
14 0.5
15 0.55
16 0.64
17 0.72
18 0.76
19 0.78
20 0.79
21 0.8
22 0.84
23 0.82
24 0.81
25 0.83
26 0.84
27 0.85
28 0.81
29 0.78
30 0.74
31 0.68
32 0.64
33 0.55
34 0.46
35 0.38
36 0.36
37 0.29
38 0.27
39 0.26
40 0.23
41 0.23
42 0.23
43 0.22
44 0.23
45 0.26
46 0.25
47 0.29
48 0.32
49 0.33
50 0.33
51 0.38
52 0.38
53 0.39
54 0.42
55 0.39
56 0.35
57 0.33
58 0.32
59 0.26
60 0.25
61 0.2
62 0.19
63 0.18
64 0.2
65 0.2
66 0.19
67 0.19
68 0.16
69 0.15
70 0.14
71 0.14
72 0.13
73 0.15
74 0.16
75 0.18
76 0.22
77 0.24
78 0.26
79 0.29
80 0.29
81 0.3
82 0.38
83 0.39
84 0.37
85 0.38
86 0.35
87 0.33
88 0.33
89 0.31
90 0.23
91 0.21
92 0.19
93 0.2
94 0.22
95 0.21
96 0.21
97 0.21
98 0.21