Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q4WN56

Protein Details
Accession Q4WN56    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
91-111SETPAEPKRRRKSRANAETNTHydrophilic
NLS Segment(s)
PositionSequence
72-104PQKPVAVRKRKSMGNVKAESETPAEPKRRRKSR
Subcellular Location(s) mito 20, cyto_mito 12, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
IPR000953  Chromo/chromo_shadow_dom  
IPR008251  Chromo_shadow_dom  
Gene Ontology GO:0005634  C:nucleus  
GO:0005721  C:pericentric heterochromatin  
GO:0003682  F:chromatin binding  
GO:0035064  F:methylated histone binding  
GO:0006325  P:chromatin organization  
GO:0000122  P:negative regulation of transcription by RNA polymerase II  
KEGG afm:AFUA_6G07550  -  
Pfam View protein in Pfam  
PF01393  Chromo_shadow  
PROSITE View protein in PROSITE  
PS50013  CHROMO_2  
CDD cd00024  CD_CSD  
Amino Acid Sequences MTATLLKRSWVMSSQRMYVIGHRNHFPGKLMLQVKWHGYDDPADQTLEPEENLLVGAKEILDEYFRAQGGRPQKPVAVRKRKSMGNVKAESETPAEPKRRRKSRANAETNTEMPEASDVPDWVPRSKNWEKDVEKVDTIIRDPKTNSLIAFLKWTNGKTAKVSIETCYEKCPRQASFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.38
3 0.38
4 0.36
5 0.37
6 0.4
7 0.39
8 0.39
9 0.38
10 0.4
11 0.41
12 0.41
13 0.36
14 0.31
15 0.26
16 0.3
17 0.3
18 0.29
19 0.31
20 0.33
21 0.33
22 0.32
23 0.31
24 0.24
25 0.22
26 0.23
27 0.21
28 0.21
29 0.2
30 0.18
31 0.16
32 0.16
33 0.17
34 0.15
35 0.12
36 0.09
37 0.08
38 0.07
39 0.07
40 0.07
41 0.05
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.05
49 0.05
50 0.06
51 0.08
52 0.09
53 0.09
54 0.09
55 0.13
56 0.21
57 0.26
58 0.27
59 0.26
60 0.29
61 0.35
62 0.43
63 0.5
64 0.52
65 0.49
66 0.54
67 0.58
68 0.58
69 0.58
70 0.59
71 0.57
72 0.54
73 0.54
74 0.49
75 0.45
76 0.42
77 0.37
78 0.29
79 0.21
80 0.16
81 0.19
82 0.24
83 0.28
84 0.38
85 0.47
86 0.54
87 0.6
88 0.66
89 0.72
90 0.77
91 0.83
92 0.82
93 0.74
94 0.71
95 0.68
96 0.59
97 0.5
98 0.39
99 0.28
100 0.19
101 0.17
102 0.12
103 0.1
104 0.09
105 0.07
106 0.08
107 0.12
108 0.13
109 0.15
110 0.17
111 0.16
112 0.24
113 0.31
114 0.37
115 0.37
116 0.46
117 0.46
118 0.52
119 0.56
120 0.52
121 0.46
122 0.4
123 0.38
124 0.3
125 0.29
126 0.28
127 0.24
128 0.24
129 0.25
130 0.28
131 0.29
132 0.29
133 0.27
134 0.26
135 0.26
136 0.23
137 0.27
138 0.23
139 0.24
140 0.25
141 0.26
142 0.28
143 0.3
144 0.31
145 0.3
146 0.35
147 0.34
148 0.37
149 0.37
150 0.33
151 0.37
152 0.4
153 0.38
154 0.39
155 0.4
156 0.39
157 0.43
158 0.46