Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9XX20

Protein Details
Accession A0A0C9XX20    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
44-64SGSCWTRNSKIRQRLSQQKLFHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 16, mito 7, pero 2
Family & Domain DBs
Amino Acid Sequences MFHGALRVVALLSLIYTGFAQKHALDCVVDGFAHLEHFPCARLSGSCWTRNSKIRQRLSQQKLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.06
5 0.06
6 0.07
7 0.08
8 0.09
9 0.1
10 0.11
11 0.11
12 0.1
13 0.1
14 0.1
15 0.09
16 0.08
17 0.06
18 0.06
19 0.05
20 0.06
21 0.06
22 0.05
23 0.06
24 0.06
25 0.07
26 0.07
27 0.08
28 0.08
29 0.08
30 0.11
31 0.2
32 0.25
33 0.29
34 0.32
35 0.37
36 0.42
37 0.5
38 0.57
39 0.58
40 0.63
41 0.67
42 0.73
43 0.77
44 0.82