Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9X4C7

Protein Details
Accession A0A0C9X4C7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
82-107SPTPAPSRPSRAKKNNSKAVKNFPASHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 8
Family & Domain DBs
Amino Acid Sequences MSEPRKLRSRKLQPVVLLSPVGRGKASTKKGAEKAAQESATDADPGGNVIGKSAPTQATGRPTRSRATKIANAVVNTTVNDSPTPAPSRPSRAKKNNSKAVKNFPASESDPNLSSPMVDKYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.67
3 0.58
4 0.49
5 0.38
6 0.35
7 0.3
8 0.26
9 0.19
10 0.17
11 0.2
12 0.27
13 0.32
14 0.34
15 0.37
16 0.43
17 0.47
18 0.52
19 0.51
20 0.47
21 0.47
22 0.45
23 0.41
24 0.34
25 0.31
26 0.26
27 0.22
28 0.18
29 0.13
30 0.07
31 0.06
32 0.07
33 0.06
34 0.05
35 0.05
36 0.05
37 0.06
38 0.06
39 0.07
40 0.08
41 0.08
42 0.09
43 0.1
44 0.12
45 0.18
46 0.21
47 0.25
48 0.26
49 0.28
50 0.3
51 0.33
52 0.35
53 0.32
54 0.35
55 0.36
56 0.36
57 0.39
58 0.37
59 0.34
60 0.31
61 0.27
62 0.22
63 0.18
64 0.17
65 0.13
66 0.11
67 0.1
68 0.12
69 0.11
70 0.15
71 0.18
72 0.16
73 0.2
74 0.23
75 0.31
76 0.39
77 0.48
78 0.55
79 0.61
80 0.71
81 0.78
82 0.85
83 0.87
84 0.86
85 0.86
86 0.83
87 0.83
88 0.81
89 0.75
90 0.67
91 0.58
92 0.55
93 0.49
94 0.48
95 0.42
96 0.36
97 0.32
98 0.31
99 0.31
100 0.24
101 0.21
102 0.18