Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9WT56

Protein Details
Accession A0A0C9WT56    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
5-24GVAPRAKMNQQRSRRFRTAKHydrophilic
NLS Segment(s)
PositionSequence
18-27RRFRTAKEAK
Subcellular Location(s) mito 14, nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR027073  5_3_exoribonuclease  
IPR004859  Xrn1_N  
Gene Ontology GO:0004534  F:5'-3' RNA exonuclease activity  
GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF03159  XRN_N  
Amino Acid Sequences MAVDGVAPRAKMNQQRSRRFRTAKEAKEVREKAELKGEKLPTEKAFDSNCITPGESPPSFFVQRSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.64
3 0.72
4 0.78
5 0.81
6 0.78
7 0.73
8 0.74
9 0.74
10 0.69
11 0.71
12 0.67
13 0.61
14 0.66
15 0.62
16 0.53
17 0.52
18 0.47
19 0.38
20 0.42
21 0.4
22 0.32
23 0.37
24 0.35
25 0.29
26 0.3
27 0.32
28 0.25
29 0.29
30 0.27
31 0.25
32 0.25
33 0.25
34 0.28
35 0.26
36 0.26
37 0.22
38 0.22
39 0.2
40 0.22
41 0.26
42 0.23
43 0.23
44 0.24
45 0.29
46 0.3