Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q4WMT2

Protein Details
Accession Q4WMT2    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
284-314VQYSSSSPPLSRRRRRRMKRNRAPECIRISLHydrophilic
NLS Segment(s)
PositionSequence
294-305SRRRRRRMKRNR
Subcellular Location(s) mito 19, cyto_nucl 4, nucl 3.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010218  NADH_DH_suC  
IPR037232  NADH_quin_OxRdtase_su_C/D-like  
IPR001268  NADH_UbQ_OxRdtase_30kDa_su  
IPR020396  NADH_UbQ_OxRdtase_CS  
Gene Ontology GO:0005747  C:mitochondrial respiratory chain complex I  
GO:0008137  F:NADH dehydrogenase (ubiquinone) activity  
KEGG afm:AFUA_6G08810  -  
Pfam View protein in Pfam  
PF00329  Complex1_30kDa  
PROSITE View protein in PROSITE  
PS00542  COMPLEX1_30K  
Amino Acid Sequences MASARSLMRLSTGRSLASAVRSSQTCRAFSSTVQLASKVPEPENMRQAHRPPQGALRAPVVNPADKYQDKTESLHKYGQYVMSCLPKYVQQFSVWKDELTIYVPPTGIIPVMSFLKYHTAAEFTQISDITAVDFPTRDQRFEVVYNLLSIRYNSRIRVKTYADEASPVPSVTGLYEGALWYEREVYDLFGVFFSGHPDLRRIMTDYGFDGHPLRKDFPLTGYTELRYDEEKKRIVIEPLELTQAFRNFEGGTTAWEPVGSGVDRKPDSVCLVTNSCEAMETNMVQYSSSSPPLSRRRRRRMKRNRAPECIRISLSRCLYVHTAYTSTNLSIQTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.28
3 0.26
4 0.28
5 0.26
6 0.21
7 0.24
8 0.26
9 0.29
10 0.35
11 0.38
12 0.34
13 0.35
14 0.38
15 0.36
16 0.35
17 0.38
18 0.35
19 0.34
20 0.34
21 0.31
22 0.27
23 0.28
24 0.33
25 0.29
26 0.25
27 0.27
28 0.32
29 0.37
30 0.44
31 0.44
32 0.45
33 0.47
34 0.52
35 0.55
36 0.55
37 0.52
38 0.47
39 0.51
40 0.54
41 0.52
42 0.49
43 0.44
44 0.4
45 0.37
46 0.41
47 0.35
48 0.31
49 0.27
50 0.27
51 0.3
52 0.29
53 0.33
54 0.31
55 0.35
56 0.34
57 0.35
58 0.42
59 0.42
60 0.44
61 0.45
62 0.41
63 0.37
64 0.37
65 0.4
66 0.32
67 0.26
68 0.25
69 0.27
70 0.27
71 0.25
72 0.24
73 0.23
74 0.25
75 0.28
76 0.27
77 0.24
78 0.28
79 0.31
80 0.39
81 0.35
82 0.32
83 0.29
84 0.27
85 0.24
86 0.21
87 0.2
88 0.13
89 0.13
90 0.13
91 0.12
92 0.12
93 0.11
94 0.09
95 0.07
96 0.06
97 0.07
98 0.08
99 0.08
100 0.08
101 0.08
102 0.12
103 0.13
104 0.13
105 0.12
106 0.13
107 0.13
108 0.16
109 0.16
110 0.12
111 0.13
112 0.12
113 0.12
114 0.1
115 0.09
116 0.08
117 0.07
118 0.07
119 0.06
120 0.07
121 0.07
122 0.16
123 0.17
124 0.16
125 0.16
126 0.17
127 0.2
128 0.21
129 0.22
130 0.15
131 0.14
132 0.14
133 0.14
134 0.13
135 0.11
136 0.1
137 0.1
138 0.14
139 0.15
140 0.17
141 0.25
142 0.28
143 0.31
144 0.35
145 0.36
146 0.32
147 0.35
148 0.34
149 0.26
150 0.24
151 0.21
152 0.18
153 0.16
154 0.14
155 0.1
156 0.08
157 0.08
158 0.06
159 0.07
160 0.05
161 0.04
162 0.05
163 0.05
164 0.05
165 0.06
166 0.06
167 0.05
168 0.06
169 0.05
170 0.06
171 0.07
172 0.07
173 0.07
174 0.07
175 0.07
176 0.06
177 0.07
178 0.06
179 0.06
180 0.07
181 0.08
182 0.09
183 0.09
184 0.11
185 0.12
186 0.12
187 0.13
188 0.14
189 0.15
190 0.15
191 0.15
192 0.15
193 0.15
194 0.14
195 0.14
196 0.13
197 0.13
198 0.16
199 0.17
200 0.19
201 0.18
202 0.19
203 0.19
204 0.2
205 0.21
206 0.2
207 0.22
208 0.22
209 0.21
210 0.21
211 0.21
212 0.2
213 0.19
214 0.22
215 0.25
216 0.29
217 0.3
218 0.3
219 0.32
220 0.33
221 0.33
222 0.3
223 0.27
224 0.24
225 0.23
226 0.26
227 0.22
228 0.21
229 0.21
230 0.22
231 0.19
232 0.16
233 0.17
234 0.14
235 0.14
236 0.15
237 0.12
238 0.14
239 0.14
240 0.15
241 0.13
242 0.13
243 0.13
244 0.11
245 0.13
246 0.09
247 0.1
248 0.11
249 0.18
250 0.19
251 0.2
252 0.21
253 0.2
254 0.23
255 0.23
256 0.23
257 0.21
258 0.23
259 0.24
260 0.24
261 0.22
262 0.18
263 0.17
264 0.15
265 0.13
266 0.13
267 0.12
268 0.13
269 0.14
270 0.14
271 0.13
272 0.14
273 0.15
274 0.16
275 0.19
276 0.19
277 0.18
278 0.27
279 0.38
280 0.48
281 0.55
282 0.63
283 0.71
284 0.82
285 0.91
286 0.94
287 0.95
288 0.96
289 0.96
290 0.96
291 0.95
292 0.94
293 0.9
294 0.88
295 0.84
296 0.78
297 0.7
298 0.64
299 0.58
300 0.56
301 0.52
302 0.49
303 0.41
304 0.39
305 0.39
306 0.36
307 0.34
308 0.29
309 0.28
310 0.23
311 0.25
312 0.24
313 0.22
314 0.23