Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9X9Y9

Protein Details
Accession A0A0C9X9Y9    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
51-76VHRIAFPRPRRRSFSRKRPVNLAFRLHydrophilic
NLS Segment(s)
PositionSequence
58-69RPRRRSFSRKRP
Subcellular Location(s) nucl 14, cyto_nucl 11, cyto 6, mito 5
Family & Domain DBs
Amino Acid Sequences MTRSPPTKSQVAAETTPTASSPEVNDTASRTSVHIIPNTNTTTIMTISLFVHRIAFPRPRRRSFSRKRPVNLAFRLEKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.29
3 0.27
4 0.24
5 0.19
6 0.15
7 0.14
8 0.12
9 0.14
10 0.14
11 0.14
12 0.15
13 0.15
14 0.16
15 0.16
16 0.15
17 0.12
18 0.13
19 0.14
20 0.16
21 0.17
22 0.17
23 0.17
24 0.2
25 0.2
26 0.19
27 0.17
28 0.15
29 0.13
30 0.11
31 0.11
32 0.07
33 0.08
34 0.08
35 0.09
36 0.1
37 0.09
38 0.1
39 0.1
40 0.12
41 0.15
42 0.23
43 0.31
44 0.42
45 0.51
46 0.56
47 0.63
48 0.7
49 0.77
50 0.79
51 0.82
52 0.82
53 0.82
54 0.81
55 0.83
56 0.83
57 0.82
58 0.77
59 0.74