Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9WUW7

Protein Details
Accession A0A0C9WUW7    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
44-69GLPRGPGRKRSAKRSGKKPSLTNGTSHydrophilic
NLS Segment(s)
PositionSequence
46-62PRGPGRKRSAKRSGKKP
Subcellular Location(s) nucl 16, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR014722  Rib_L2_dom2  
Amino Acid Sequences MSAQNAPRSSLTSTQAIIDAPTTGVPRQSYRYKHLTLTPLKLSGLPRGPGRKRSAKRSGKKPSLTNGTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.2
4 0.17
5 0.13
6 0.1
7 0.08
8 0.08
9 0.09
10 0.08
11 0.11
12 0.12
13 0.13
14 0.18
15 0.24
16 0.27
17 0.31
18 0.37
19 0.37
20 0.37
21 0.39
22 0.41
23 0.39
24 0.39
25 0.35
26 0.3
27 0.29
28 0.29
29 0.27
30 0.25
31 0.25
32 0.23
33 0.26
34 0.35
35 0.39
36 0.43
37 0.5
38 0.55
39 0.57
40 0.65
41 0.71
42 0.72
43 0.78
44 0.82
45 0.86
46 0.85
47 0.86
48 0.83
49 0.81