Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9Y568

Protein Details
Accession A0A0C9Y568    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
50-91QEPSSPKEPKRKIGRPKKEQTPNLTPKKPRERKSSLRAKTQDHydrophilic
NLS Segment(s)
PositionSequence
55-87PKEPKRKIGRPKKEQTPNLTPKKPRERKSSLRA
Subcellular Location(s) mito 16, nucl 10.5, cyto_nucl 6
Family & Domain DBs
Amino Acid Sequences MHSSLLRRALASLQVDTCLACSTSRWYSSKGSWEWRREKTPWRNVEAWNQEPSSPKEPKRKIGRPKKEQTPNLTPKKPRERKSSLRAKTQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.18
4 0.17
5 0.12
6 0.1
7 0.08
8 0.08
9 0.13
10 0.17
11 0.21
12 0.22
13 0.25
14 0.28
15 0.31
16 0.37
17 0.35
18 0.41
19 0.44
20 0.51
21 0.55
22 0.57
23 0.6
24 0.56
25 0.63
26 0.63
27 0.65
28 0.62
29 0.6
30 0.58
31 0.55
32 0.59
33 0.55
34 0.48
35 0.41
36 0.36
37 0.32
38 0.32
39 0.34
40 0.32
41 0.32
42 0.36
43 0.43
44 0.47
45 0.55
46 0.62
47 0.67
48 0.72
49 0.77
50 0.82
51 0.82
52 0.87
53 0.89
54 0.88
55 0.86
56 0.84
57 0.83
58 0.83
59 0.82
60 0.81
61 0.77
62 0.77
63 0.82
64 0.83
65 0.8
66 0.8
67 0.8
68 0.82
69 0.86
70 0.86
71 0.83