Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9Y1B2

Protein Details
Accession A0A0C9Y1B2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
89-108QESWKNRRKTRESASPQAKLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR008011  Complex1_LYR_dom  
IPR045295  Complex1_LYR_SDHAF1_LYRM8  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0034553  P:mitochondrial respiratory chain complex II assembly  
Pfam View protein in Pfam  
PF05347  Complex1_LYR  
CDD cd20268  Complex1_LYR_SDHAF1_LYRM8  
Amino Acid Sequences MALTRSGLQKDVLSLYRRALRMVRTKPPLTQPKFLLVLRYTFHANASAISPRNVSAIEHLLRKGTRQIEMYEDDAVKDVWVSSEMLQWQESWKNRRKTRESASPQAKLGQTIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.28
3 0.33
4 0.32
5 0.33
6 0.32
7 0.34
8 0.41
9 0.46
10 0.51
11 0.52
12 0.54
13 0.56
14 0.62
15 0.65
16 0.61
17 0.6
18 0.53
19 0.5
20 0.52
21 0.48
22 0.43
23 0.33
24 0.31
25 0.25
26 0.25
27 0.22
28 0.18
29 0.18
30 0.14
31 0.13
32 0.11
33 0.12
34 0.14
35 0.13
36 0.13
37 0.13
38 0.12
39 0.12
40 0.12
41 0.1
42 0.09
43 0.12
44 0.13
45 0.13
46 0.13
47 0.15
48 0.15
49 0.15
50 0.19
51 0.16
52 0.18
53 0.18
54 0.19
55 0.21
56 0.23
57 0.23
58 0.2
59 0.19
60 0.16
61 0.15
62 0.14
63 0.1
64 0.08
65 0.07
66 0.05
67 0.06
68 0.07
69 0.07
70 0.1
71 0.11
72 0.12
73 0.12
74 0.12
75 0.15
76 0.21
77 0.27
78 0.33
79 0.41
80 0.5
81 0.57
82 0.67
83 0.71
84 0.74
85 0.76
86 0.79
87 0.79
88 0.79
89 0.81
90 0.75
91 0.7
92 0.66
93 0.58