Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9XTU6

Protein Details
Accession A0A0C9XTU6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
53-75LLPLSWKKKIQPKKWIGRFGTGCHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 13.5, mito 12, cyto_nucl 7.5
Family & Domain DBs
Amino Acid Sequences MWKTILTPCAFNAPGRCQDGSGVWEGGAVCCLDPEAEYDVPTPPDHNDITAILLPLSWKKKIQPKKWIGRFGTGCNG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.37
3 0.36
4 0.29
5 0.3
6 0.29
7 0.26
8 0.23
9 0.17
10 0.13
11 0.13
12 0.13
13 0.12
14 0.1
15 0.08
16 0.05
17 0.05
18 0.05
19 0.04
20 0.04
21 0.06
22 0.09
23 0.09
24 0.09
25 0.1
26 0.11
27 0.12
28 0.12
29 0.11
30 0.08
31 0.12
32 0.11
33 0.11
34 0.11
35 0.1
36 0.13
37 0.13
38 0.12
39 0.08
40 0.08
41 0.09
42 0.14
43 0.17
44 0.17
45 0.18
46 0.24
47 0.35
48 0.45
49 0.54
50 0.6
51 0.67
52 0.76
53 0.84
54 0.87
55 0.81
56 0.8
57 0.75