Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9Y8R3

Protein Details
Accession A0A0C9Y8R3    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-27RSPYSLQRKHGVKRIRQTAQDREAKRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, mito_nucl 13, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002088  Prenyl_trans_a  
Gene Ontology GO:0005968  C:Rab-protein geranylgeranyltransferase complex  
GO:0004663  F:Rab geranylgeranyltransferase activity  
GO:0018344  P:protein geranylgeranylation  
Pfam View protein in Pfam  
PF01239  PPTA  
PROSITE View protein in PROSITE  
PS51147  PFTA  
Amino Acid Sequences MRSPYSLQRKHGVKRIRQTAQDREAKRQREQSRIKDYLALTNVILTGKKNKDWSEDAFNLTTRILQLNPEFYTAWNYRRNIFAWINFASSHQGILKILSEDLSMTMTALKAHPKVYWIWNHRRWCLENIPDLSESDPNDNTWKKEAWDRELFVVEKMLDSDPRNFHAWDYRRYILANMPIPRPPASELAYTSRKIESNFSNFSAWHQRSKVLSSLWESGDLDESKSKEKDRNIWCAEFELIRNAMYTDPNDQSVWMYHRWLVGSSKSCLLVIAHHLIASVRECHCCLSSNNFNVFNIGCMESIVCYKRMLIKDHATDVDLAMLTRECNGMLQQLQELDPLRRRRYEDLVGTLLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.8
3 0.78
4 0.79
5 0.79
6 0.8
7 0.8
8 0.8
9 0.73
10 0.73
11 0.75
12 0.72
13 0.71
14 0.71
15 0.69
16 0.7
17 0.77
18 0.76
19 0.78
20 0.76
21 0.7
22 0.66
23 0.6
24 0.57
25 0.5
26 0.41
27 0.3
28 0.27
29 0.26
30 0.21
31 0.2
32 0.14
33 0.21
34 0.24
35 0.28
36 0.33
37 0.34
38 0.4
39 0.44
40 0.47
41 0.47
42 0.46
43 0.46
44 0.41
45 0.39
46 0.34
47 0.29
48 0.25
49 0.17
50 0.16
51 0.12
52 0.15
53 0.16
54 0.2
55 0.21
56 0.22
57 0.21
58 0.2
59 0.26
60 0.25
61 0.29
62 0.31
63 0.32
64 0.31
65 0.34
66 0.35
67 0.35
68 0.35
69 0.32
70 0.3
71 0.3
72 0.3
73 0.27
74 0.26
75 0.23
76 0.2
77 0.18
78 0.14
79 0.13
80 0.12
81 0.13
82 0.13
83 0.11
84 0.1
85 0.1
86 0.09
87 0.08
88 0.08
89 0.08
90 0.07
91 0.06
92 0.06
93 0.06
94 0.07
95 0.08
96 0.11
97 0.12
98 0.13
99 0.14
100 0.15
101 0.18
102 0.23
103 0.31
104 0.35
105 0.44
106 0.51
107 0.56
108 0.58
109 0.6
110 0.57
111 0.54
112 0.52
113 0.47
114 0.46
115 0.42
116 0.41
117 0.36
118 0.34
119 0.3
120 0.25
121 0.21
122 0.17
123 0.15
124 0.13
125 0.18
126 0.19
127 0.2
128 0.2
129 0.2
130 0.19
131 0.25
132 0.28
133 0.29
134 0.32
135 0.32
136 0.31
137 0.32
138 0.31
139 0.25
140 0.23
141 0.16
142 0.11
143 0.11
144 0.1
145 0.1
146 0.11
147 0.16
148 0.16
149 0.18
150 0.2
151 0.19
152 0.19
153 0.25
154 0.27
155 0.28
156 0.32
157 0.3
158 0.29
159 0.29
160 0.3
161 0.24
162 0.25
163 0.25
164 0.22
165 0.22
166 0.23
167 0.24
168 0.24
169 0.22
170 0.19
171 0.17
172 0.17
173 0.17
174 0.17
175 0.21
176 0.24
177 0.23
178 0.23
179 0.21
180 0.2
181 0.2
182 0.22
183 0.21
184 0.24
185 0.26
186 0.26
187 0.25
188 0.24
189 0.26
190 0.32
191 0.29
192 0.28
193 0.26
194 0.28
195 0.28
196 0.31
197 0.3
198 0.21
199 0.22
200 0.22
201 0.24
202 0.21
203 0.21
204 0.19
205 0.16
206 0.19
207 0.17
208 0.15
209 0.14
210 0.15
211 0.17
212 0.19
213 0.22
214 0.23
215 0.27
216 0.35
217 0.38
218 0.47
219 0.48
220 0.48
221 0.46
222 0.42
223 0.4
224 0.31
225 0.26
226 0.19
227 0.15
228 0.14
229 0.13
230 0.12
231 0.12
232 0.12
233 0.13
234 0.14
235 0.14
236 0.16
237 0.16
238 0.15
239 0.15
240 0.17
241 0.19
242 0.16
243 0.16
244 0.16
245 0.17
246 0.18
247 0.18
248 0.18
249 0.21
250 0.24
251 0.24
252 0.25
253 0.24
254 0.23
255 0.22
256 0.2
257 0.16
258 0.16
259 0.18
260 0.16
261 0.15
262 0.15
263 0.15
264 0.16
265 0.16
266 0.16
267 0.14
268 0.16
269 0.17
270 0.19
271 0.2
272 0.21
273 0.22
274 0.26
275 0.33
276 0.38
277 0.42
278 0.42
279 0.41
280 0.4
281 0.37
282 0.3
283 0.24
284 0.18
285 0.13
286 0.12
287 0.12
288 0.11
289 0.15
290 0.16
291 0.14
292 0.14
293 0.15
294 0.23
295 0.27
296 0.31
297 0.34
298 0.4
299 0.44
300 0.48
301 0.47
302 0.41
303 0.37
304 0.32
305 0.28
306 0.2
307 0.15
308 0.11
309 0.11
310 0.1
311 0.1
312 0.11
313 0.08
314 0.09
315 0.1
316 0.14
317 0.15
318 0.16
319 0.17
320 0.18
321 0.19
322 0.21
323 0.23
324 0.24
325 0.31
326 0.38
327 0.42
328 0.46
329 0.51
330 0.53
331 0.59
332 0.62
333 0.6
334 0.58