Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9WWS9

Protein Details
Accession A0A0C9WWS9    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
54-77AAENPSPRRSKRRREPTPDKDSSEHydrophilic
NLS Segment(s)
PositionSequence
61-67RRSKRRR
Subcellular Location(s) nucl 18, cyto 2.5, cyto_mito 2.5, plas 2, pero 2
Family & Domain DBs
Amino Acid Sequences MDFLNYIHCYFSSPPEPNVTEIHSGLSLSQISMDNLRVHVQSFGAPDPENPSTAAENPSPRRSKRRREPTPDKDSSEVKIITPPKKLWNNIPVGPVRKIFTFVLFNILLLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.35
3 0.36
4 0.35
5 0.35
6 0.33
7 0.28
8 0.25
9 0.24
10 0.18
11 0.17
12 0.14
13 0.14
14 0.11
15 0.08
16 0.09
17 0.08
18 0.09
19 0.1
20 0.12
21 0.11
22 0.12
23 0.14
24 0.12
25 0.12
26 0.12
27 0.11
28 0.11
29 0.12
30 0.11
31 0.11
32 0.11
33 0.11
34 0.15
35 0.15
36 0.14
37 0.13
38 0.14
39 0.13
40 0.14
41 0.16
42 0.13
43 0.18
44 0.21
45 0.27
46 0.3
47 0.32
48 0.42
49 0.48
50 0.57
51 0.63
52 0.71
53 0.75
54 0.8
55 0.89
56 0.88
57 0.9
58 0.84
59 0.77
60 0.69
61 0.61
62 0.52
63 0.46
64 0.36
65 0.27
66 0.28
67 0.31
68 0.32
69 0.35
70 0.35
71 0.39
72 0.46
73 0.49
74 0.5
75 0.52
76 0.54
77 0.52
78 0.56
79 0.52
80 0.5
81 0.5
82 0.45
83 0.39
84 0.33
85 0.34
86 0.29
87 0.28
88 0.27
89 0.24
90 0.27
91 0.25