Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9XVB5

Protein Details
Accession A0A0C9XVB5    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
54-87LGDKTNEKKKKEEKTKKGEEKKRPKEPPKPQKVKBasic
NLS Segment(s)
PositionSequence
59-87NEKKKKEEKTKKGEEKKRPKEPPKPQKVK
Subcellular Location(s) nucl 14, cyto_nucl 11.833, mito_nucl 9.333, cyto 8.5
Family & Domain DBs
Amino Acid Sequences MGDPCFVVVISAKVKCILKRWFNSKIKGKNESDNSNLISPPGYNYRGVPENKALGDKTNEKKKKEEKTKKGEEKKRPKEPPKPQKVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.31
4 0.37
5 0.41
6 0.48
7 0.55
8 0.61
9 0.65
10 0.72
11 0.74
12 0.74
13 0.72
14 0.72
15 0.68
16 0.66
17 0.65
18 0.61
19 0.54
20 0.47
21 0.42
22 0.35
23 0.32
24 0.24
25 0.18
26 0.13
27 0.12
28 0.13
29 0.13
30 0.12
31 0.12
32 0.15
33 0.21
34 0.21
35 0.22
36 0.2
37 0.21
38 0.21
39 0.23
40 0.2
41 0.17
42 0.2
43 0.26
44 0.31
45 0.4
46 0.46
47 0.47
48 0.55
49 0.62
50 0.69
51 0.72
52 0.76
53 0.76
54 0.8
55 0.89
56 0.91
57 0.93
58 0.92
59 0.92
60 0.92
61 0.92
62 0.93
63 0.92
64 0.92
65 0.92
66 0.93
67 0.93