Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9WIR8

Protein Details
Accession A0A0C9WIR8    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
14-35EYTGIRPRTMRRLRKRFRVTGEHydrophilic
NLS Segment(s)
PositionSequence
24-29RRLRKR
Subcellular Location(s) mito_nucl 10.166, nucl 10, mito 10, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
Amino Acid Sequences MSLHCGLSDTKISEYTGIRPRTMRRLRKRFRVTGEVVKKPVVNGRPRLLNSLDATFLEAPPDVFQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.25
3 0.29
4 0.3
5 0.3
6 0.32
7 0.35
8 0.43
9 0.51
10 0.55
11 0.58
12 0.67
13 0.73
14 0.81
15 0.85
16 0.81
17 0.77
18 0.74
19 0.67
20 0.66
21 0.65
22 0.58
23 0.52
24 0.46
25 0.4
26 0.34
27 0.35
28 0.32
29 0.31
30 0.33
31 0.35
32 0.41
33 0.42
34 0.45
35 0.41
36 0.39
37 0.35
38 0.31
39 0.28
40 0.22
41 0.24
42 0.21
43 0.19
44 0.16
45 0.14