Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9Y550

Protein Details
Accession A0A0C9Y550    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
8-29ELVHARARRRFQRGLKRRPMGLBasic
NLS Segment(s)
PositionSequence
13-44RARRRFQRGLKRRPMGLIKKLRKAKKEAPPNE
Subcellular Location(s) nucl 16, cyto_nucl 13, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR002222  Ribosomal_S19  
IPR023575  Ribosomal_S19_S15_SF  
IPR005713  Ribosomal_S19A/S15e  
Gene Ontology GO:0015935  C:small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00203  Ribosomal_S19  
Amino Acid Sequences MSNEDFVELVHARARRRFQRGLKRRPMGLIKKLRKAKKEAPPNEKPAVVKTHLRDMIIVPEMIGSVVGIYNGKVFNSVEIKPEMTGHYLAEFSCSYRPVKHGRPGIGATHSSRFIPLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.41
3 0.48
4 0.56
5 0.62
6 0.7
7 0.78
8 0.82
9 0.84
10 0.81
11 0.76
12 0.74
13 0.74
14 0.71
15 0.7
16 0.7
17 0.67
18 0.7
19 0.77
20 0.76
21 0.72
22 0.72
23 0.71
24 0.7
25 0.74
26 0.74
27 0.75
28 0.75
29 0.76
30 0.7
31 0.63
32 0.54
33 0.46
34 0.41
35 0.35
36 0.32
37 0.27
38 0.32
39 0.31
40 0.3
41 0.28
42 0.23
43 0.24
44 0.2
45 0.18
46 0.1
47 0.08
48 0.08
49 0.07
50 0.07
51 0.03
52 0.02
53 0.02
54 0.03
55 0.03
56 0.03
57 0.05
58 0.05
59 0.05
60 0.06
61 0.06
62 0.09
63 0.12
64 0.13
65 0.14
66 0.15
67 0.16
68 0.15
69 0.17
70 0.15
71 0.14
72 0.14
73 0.12
74 0.11
75 0.11
76 0.11
77 0.13
78 0.12
79 0.11
80 0.13
81 0.14
82 0.15
83 0.17
84 0.22
85 0.27
86 0.35
87 0.42
88 0.47
89 0.49
90 0.53
91 0.54
92 0.53
93 0.49
94 0.45
95 0.4
96 0.37
97 0.35
98 0.3