Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9WVA8

Protein Details
Accession A0A0C9WVA8    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
4-29VSSAKLRTASEKRRKKPGKFRCALCGHydrophilic
NLS Segment(s)
PositionSequence
12-22ASEKRRKKPGK
Subcellular Location(s) nucl 20, cyto_nucl 11.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences KKTVSSAKLRTASEKRRKKPGKFRCALCGNTFTEKHNLTNHHNSHRGVKPHSCERCPSAFAVRSSLTRHRKSCKQTKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.7
3 0.75
4 0.83
5 0.84
6 0.86
7 0.86
8 0.86
9 0.84
10 0.81
11 0.79
12 0.76
13 0.69
14 0.6
15 0.53
16 0.45
17 0.42
18 0.39
19 0.32
20 0.3
21 0.28
22 0.28
23 0.27
24 0.28
25 0.29
26 0.37
27 0.39
28 0.39
29 0.42
30 0.41
31 0.44
32 0.46
33 0.45
34 0.4
35 0.41
36 0.42
37 0.47
38 0.53
39 0.48
40 0.47
41 0.47
42 0.46
43 0.43
44 0.4
45 0.38
46 0.36
47 0.35
48 0.36
49 0.33
50 0.32
51 0.36
52 0.43
53 0.45
54 0.48
55 0.54
56 0.58
57 0.65
58 0.73