Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9XDN6

Protein Details
Accession A0A0C9XDN6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
49-69LDDQHRRRRRRQGEVWRQCAPBasic
NLS Segment(s)
Subcellular Location(s) extr 12, mito 10, cyto 4
Family & Domain DBs
Amino Acid Sequences MTTGGGSLTIRTALVTKSIVVFPSRIDDGVVTVQDVLLAVHYALQASALDDQHRRRRRRQGEVWRQCAPRSYYEAIDVAVGCHGWAGLTQSPTEGDVWILMTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.11
4 0.13
5 0.14
6 0.14
7 0.14
8 0.14
9 0.12
10 0.16
11 0.16
12 0.14
13 0.13
14 0.12
15 0.13
16 0.14
17 0.13
18 0.09
19 0.08
20 0.08
21 0.07
22 0.07
23 0.05
24 0.03
25 0.03
26 0.03
27 0.04
28 0.04
29 0.04
30 0.04
31 0.04
32 0.04
33 0.04
34 0.06
35 0.06
36 0.08
37 0.11
38 0.16
39 0.25
40 0.34
41 0.38
42 0.44
43 0.55
44 0.62
45 0.69
46 0.74
47 0.76
48 0.8
49 0.85
50 0.83
51 0.79
52 0.72
53 0.63
54 0.58
55 0.49
56 0.41
57 0.38
58 0.34
59 0.28
60 0.29
61 0.28
62 0.23
63 0.21
64 0.17
65 0.11
66 0.09
67 0.08
68 0.06
69 0.05
70 0.05
71 0.04
72 0.04
73 0.08
74 0.11
75 0.12
76 0.13
77 0.14
78 0.14
79 0.16
80 0.16
81 0.12
82 0.09
83 0.09