Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9WQK5

Protein Details
Accession A0A0C9WQK5    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
71-90DTRGNKKQKKEDEKVANRREBasic
101-122SGANGRRKRKQGGSRDRNPGPYBasic
NLS Segment(s)
PositionSequence
103-115ANGRRKRKQGGSR
Subcellular Location(s) nucl 13.5, cyto_nucl 11.333, cyto 8, cyto_mito 5.833, mito 2.5
Family & Domain DBs
Amino Acid Sequences MQKDLCQLDDLAALVCPPLSPAVKWLRYGTAVTLTIGAKSAQVFGLWRPSNVVAPIETEQVASEENDVELDTRGNKKQKKEDEKVANRRESLGLERDSVPSGANGRRKRKQGGSRDRNPGPYAPYSTGSIKNID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.05
5 0.08
6 0.09
7 0.09
8 0.16
9 0.25
10 0.27
11 0.3
12 0.31
13 0.3
14 0.31
15 0.32
16 0.27
17 0.22
18 0.2
19 0.18
20 0.19
21 0.16
22 0.15
23 0.15
24 0.13
25 0.09
26 0.09
27 0.09
28 0.07
29 0.07
30 0.08
31 0.08
32 0.17
33 0.17
34 0.16
35 0.18
36 0.18
37 0.2
38 0.2
39 0.19
40 0.1
41 0.13
42 0.14
43 0.12
44 0.12
45 0.1
46 0.09
47 0.09
48 0.09
49 0.07
50 0.06
51 0.05
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.06
59 0.09
60 0.14
61 0.21
62 0.25
63 0.31
64 0.4
65 0.5
66 0.58
67 0.61
68 0.67
69 0.71
70 0.77
71 0.81
72 0.8
73 0.73
74 0.64
75 0.59
76 0.5
77 0.42
78 0.35
79 0.3
80 0.24
81 0.23
82 0.24
83 0.23
84 0.23
85 0.21
86 0.17
87 0.13
88 0.16
89 0.2
90 0.27
91 0.34
92 0.42
93 0.49
94 0.55
95 0.62
96 0.68
97 0.72
98 0.75
99 0.78
100 0.79
101 0.81
102 0.85
103 0.81
104 0.77
105 0.7
106 0.62
107 0.56
108 0.5
109 0.46
110 0.4
111 0.38
112 0.37
113 0.38
114 0.39